SDS-Page
(Recombinant Human Fc gamma RIIIB/CD16b Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-42 kDa.)
Fc gamma RIIIB/CD16b Recombinant Protein | FCGR3B recombinant protein
Recombinant Human Fc gamma RIIIB/CD16b Protein
Gene Names
FCGR3B; CD16; FCG3; CD16A; CD16b; FCGR3; FCGR3A; FCR-10; FCRIII; FCRIIIb
Purity
>97% by SDS-PAGE.
Synonyms
Fc gamma RIIIB/CD16b; Recombinant Human Fc gamma RIIIB/CD16b Protein; CD16; CD16b; Fc gamma RIIIb; FCG3; FCGR3; FCR-10; FCRIII; FCRIIIb; FCGR3B recombinant protein
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQ
Sequence Length
233
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human Fc gamma RIIIB/CD16b Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-42 kDa.)
SDS-Page
(Recombinant Human Fc gamma RIIIB/CD16b Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 35-42 kDa.)
Related Product Information for FCGR3B recombinant protein
Description: Recombinant Human Fc gamma RIIIB/CD16b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr20-Gln208) of human Fc gamma RIIIB/CD16b (Accession #NP_000561.3) fused with a 6xHis tag at the C-terminus.
Background: CD16 is a low affinity Fc receptor, and has been identified as Fc receptors FcgammaRIIIa (CD16a) and FcgammaRIIIb (CD16b). These receptors function in the activation or inhibition of immune responses. CD16 encoded by two different highly homologous genes in a cell type-specific manner.CD16 is found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16B is also kown as FCGR3B and FCG3B, is expressed specifically by polymorphonuclear leukocytes (neutrophils) and stimulated eosinophils. CD16B is the low affinity receptor for the Fc region of immunoglobulins gamma. CD16B may serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Background: CD16 is a low affinity Fc receptor, and has been identified as Fc receptors FcgammaRIIIa (CD16a) and FcgammaRIIIb (CD16b). These receptors function in the activation or inhibition of immune responses. CD16 encoded by two different highly homologous genes in a cell type-specific manner.CD16 is found on the surface of natural killer cells, neutrophil polymorphonuclear leukocytes, monocytes and macrophages. CD16B is also kown as FCGR3B and FCG3B, is expressed specifically by polymorphonuclear leukocytes (neutrophils) and stimulated eosinophils. CD16B is the low affinity receptor for the Fc region of immunoglobulins gamma. CD16B may serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Product Categories/Family for FCGR3B recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Low affinity immunoglobulin gamma Fc region receptor III-B
NCBI Official Synonym Full Names
Fc fragment of IgG receptor IIIb
NCBI Official Symbol
FCGR3B
NCBI Official Synonym Symbols
CD16; FCG3; CD16A; CD16b; FCGR3; FCGR3A; FCR-10; FCRIII; FCRIIIb
NCBI Protein Information
low affinity immunoglobulin gamma Fc region receptor III-B
UniProt Protein Name
Low affinity immunoglobulin gamma Fc region receptor III-B
Protein Family
UniProt Gene Name
FCGR3B
UniProt Synonym Gene Names
CD16B; FCG3; FCGR3; IGFR3; Fc-gamma RIII; Fc-gamma RIIIb; FcRIII; FcRIIIb
NCBI Description
The protein encoded by this gene is a low affinity receptor for the Fc region of gamma immunoglobulins (IgG). The encoded protein acts as a monomer and can bind either monomeric or aggregated IgG. This gene may function to capture immune complexes in the peripheral circulation. Several transcript variants encoding different isoforms have been found for this gene. A highly-similar gene encoding a related protein is also found on chromosome 1. [provided by RefSeq, Aug 2012]
Uniprot Description
Receptor for the Fc region of immunoglobulins gamma. Low affinity receptor. Binds complexed or aggregated IgG and also monomeric IgG. Contrary to III-A, is not capable to mediate antibody-dependent cytotoxicity and phagocytosis. May serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Research Articles on FCGR3B
Similar Products
Product Notes
The FCGR3B fcgr3b (Catalog #AAA9141829) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TEDLPKAVVF LEPQWYSVLE KDSVTLKCQG AYSPEDNSTQ WFHNENLISS QASSYFIDAA TVNDSGEYRC QTNLSTLSDP VQLEVHIGWL LLQAPRWVFK EEDPIHLRCH SWKNTALHKV TYLQNGKDRK YFHHNSDFHI PKATLKDSGS YFCRGLVGSK NVSSETVNIT ITQGLAVSTI SSFSPPGYQ. It is sometimes possible for the material contained within the vial of "Fc gamma RIIIB/CD16b, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
