SDS-Page
(Recombinant Human CD89/FCAR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 65-75 kDa.)
CD89/FCAR Recombinant Protein | FCAR recombinant protein
Recombinant Human CD89/FCAR Protein
Gene Names
FCAR; CD89; FcalphaRI; CTB-61M7.2
Purity
>97% by SDS-PAGE.
Synonyms
CD89/FCAR; Recombinant Human CD89/FCAR Protein; CD89; CTB-61M7.2; FcalphaRI; FCAR recombinant protein
Host
HEK293 Cells
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
QEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGENISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNALELVVTDSIHQDYTTQN
Sequence Length
287
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
Fc, 6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human CD89/FCAR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 65-75 kDa.)
SDS-Page
(Recombinant Human CD89/FCAR Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 65-75 kDa.)
Related Product Information for FCAR recombinant protein
Description: Recombinant Human CD89/FCAR Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Gln22-Asn227) of human CD89/FCAR (Accession #NP_001991.1) fused with an Fc, 6xHis tag at the C-terminus.
Background: This protein is a member of the immunoglobulin gene superfamily and receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Background: This protein is a member of the immunoglobulin gene superfamily and receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for FCAR recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Immunoglobulin alpha Fc receptor
NCBI Official Synonym Full Names
Fc fragment of IgA receptor
NCBI Official Symbol
FCAR
NCBI Official Synonym Symbols
CD89; FcalphaRI; CTB-61M7.2
NCBI Protein Information
immunoglobulin alpha Fc receptor
UniProt Protein Name
Immunoglobulin alpha Fc receptor
Protein Family
UniProt Gene Name
FCAR
UniProt Synonym Gene Names
CD89; IgA Fc receptor
NCBI Description
This gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. The receptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils, monocytes, macrophages, and eosinophils, where it mediates immunologic responses to pathogens. It interacts with IgA-opsonized targets and triggers several immunologic defense processes, including phagocytosis, antibody-dependent cell-mediated cytotoxicity, and stimulation of the release of inflammatory mediators. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Uniprot Description
Binds to the Fc region of immunoglobulins alpha. Mediates several functions including cytokine production.
Research Articles on FCAR
Similar Products
Product Notes
The FCAR fcar (Catalog #AAA9139710) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QEGDFPMPFI SAKSSPVIPL DGSVKIQCQA IREAYLTQLM IIKNSTYREI GRRLKFWNET DPEFVIDHMD ANKAGRYQCQ YRIGHYRFRY SDTLELVVTG LYGKPFLSAD RGLVLMPGEN ISLTCSSAHI PFDRFSLAKE GELSLPQHQS GEHPANFSLG PVDLNVSGIY RCYGWYNRSP YLWSFPSNAL ELVVTDSIHQ DYTTQN. It is sometimes possible for the material contained within the vial of "CD89/FCAR, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
