Mouse EOMES Monoclonal Antibody | anti-EOMES antibody

EOMES (Eomesodermin Homolog (Xenopus laevis), TBR2) (HRP)

Cat. Num. AAA6182260

• Gene Names: EOMES; TBR2
• Applications: Western Blot
• Purity: Purified
• Synonyms: EOMES; Monoclonal Antibody; EOMES (Eomesodermin Homolog (Xenopus laevis); TBR2) (HRP); Eomesodermin Homolog (Xenopus laevis); TBR2; anti-EOMES antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1D5
• Specificity: Recognizes EOMES.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-EOMES antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: EOMES (NP_005433.2, 461aa-569aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SHQIVPGGRYGVQSFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTPVQQPGTNKLDISSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTF
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged EOMES is 3 ng/ml as a capture antibody.)

Product Categories/Family for anti-EOMES antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 22538470
• NCBI GeneID: 8320
• NCBI Accession #: NP_005433.2
• NCBI GenBank Nucleotide #: NM_005442.3
• UniProt Accession #: O95936; Q8TAZ2; Q9UPM7; B7Z4I2
• Molecular Weight: 72,732 Da
• NCBI Official Full Name: eomesodermin homolog isoform 2
• NCBI Official Synonym Full Names: eomesodermin
• NCBI Official Symbol: EOMES
• NCBI Official Synonym Symbols: TBR2
• NCBI Protein Information: eomesodermin homolog; T-box brain protein 2
• UniProt Protein Name: Eomesodermin homolog
• Protein Family: Eomesodermin
• UniProt Gene Name: EOMES
• UniProt Synonym Gene Names: TBR2; T-brain-2; TBR-2
• UniProt Entry Name: EOMES_HUMAN

NCBI Description

This gene belongs to the TBR1 (T-box brain protein 1) sub-family of T-box genes that share the common DNA-binding T-box domain. The encoded protein is a transcription factor which is crucial for embryonic development of mesoderm and the central nervous system in vertebrates. The protein may also be necessary for the differentiation of effector CD8+ T cells which are involved in defense against viral infections. A similar gene disrupted in mice is shown to be essential during trophoblast development and gastrulation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]

Uniprot Description

EOMES: Functions as a transcriptional activator playing a crucial role during development. Functions in trophoblast differentiation and later in gastrulation, regulating both mesoderm delamination and endoderm specification. Plays a role in brain development being required for the specification and the proliferation of the intermediate progenitor cells and their progeny in the cerebral cortex. Also involved in the differentiation of CD8+ T-cells during immune response regulating the expression of lytic effector genes. Up-regulated in CD8+ T-cells simultaneously stimulated with TGFB1 and IL4/interleukin-4. Expressed in CD8+ T-cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 3p24.1

Cellular Component: nucleus

Molecular Function: DNA binding; sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: CD8-positive, alpha-beta T cell differentiation during immune response; transcription, DNA-dependent; regulation of neuron differentiation; positive regulation of transcription, DNA-dependent; endodermal cell fate specification; olfactory bulb development; stem cell maintenance; cerebral cortex regionalization; negative regulation of transcription from RNA polymerase II promoter; trophectodermal cell differentiation; cerebral cortex neuron differentiation; cardioblast differentiation; mesoderm formation; endoderm formation; interferon-gamma production; positive regulation of transcription from RNA polymerase II promoter; brain development; positive regulation of cell differentiation