Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Protein FAM134B (Fam134b) Recombinant Protein | Fam134b recombinant protein

Recombinant Rat Protein FAM134B (Fam134b)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein FAM134B (Fam134b); Recombinant Rat Protein FAM134B (Fam134b); Fam134b recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-480aa; full length protein
Sequence
MASPAPEEHATQGCPATEEQEPRPGVPGEEAGPEGAGPQVEEAAGRVAAALTWLLGEPVL WLGWRADELLSWKRPLRSLLAFLGANLLFWFLALTPWRVYHLISVMILGRVIMQIIKDMV LSRARGAQLWRSLSESWEVINSKPDERPRLSHCIAESWMNFSIFLQEMSLFKQQSPGKFC LLVCSVCTFFTILGSYIPGVILSYLLLLFAFLCPLFKCNDIGQKIYSKVKSILLKLDFGI GEYINQKKRERSEADKEKSHKDDSEIDFSALCPKISLTVAAKELSVSDTDVSEVSWTDNG TFNLSEGYTPQTDTSDDLDRPSEEVFSRDLSDFPSLENGAGTNDEDELSLGLPTELKTKK QQLNSAHRPSKDRQSAAGLSLPLKSDQALHLMSNLAGDVITAAMTAAIKDQLEGARQALA QAAPTPGDDTDTEEGDDFELLDQAELDQIESELGLTQDQGAEAQQSKKSSGFLSNLLGGH
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Fam134b recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,782 Da
NCBI Official Full Name
reticulophagy receptor FAM134B
NCBI Official Synonym Full Names
family with sequence similarity 134, member B
NCBI Official Symbol
Fam134b
NCBI Protein Information
reticulophagy receptor FAM134B
UniProt Protein Name
Reticulophagy receptor FAM134B
Protein Family
UniProt Gene Name
Fam134b
UniProt Entry Name
F134B_RAT

Uniprot Description

FAM134B: Required for long-term survival of nociceptive and autonomic ganglion neurons. Defects in FAM134B are the cause of hereditary sensory and autonomic neuropathy type 2B (HSAN2B). A form of hereditary sensory and autonomic neuropathy, a genetically and clinically heterogeneous group of disorders characterized by degeneration of dorsal root and autonomic ganglion cells, and by sensory and/or autonomic abnormalities. HSAN2B is an autosomal recessive disorder characterized by impairment of pain, temperature and touch sensation. Onset occurs in the first or second decade, with impaired nociception and progressive mutilating ulceration of the hands and feet with osteomyelitis and acroosteolysis. Amputations of the hands and feet are common. Autonomic dysfunction includes hyperhidrosis, urinary incontinence, and slow pupillary light response. Belongs to the FAM134 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: cis-Golgi network; Golgi apparatus; integral to endoplasmic reticulum membrane

Molecular Function: nucleic acid binding; zinc ion binding

Biological Process: negative regulation of neuron apoptosis; sensory perception of pain

Similar Products

Product Notes

The Fam134b fam134b (Catalog #AAA7014515) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-480aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Fam134b fam134b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASPAPEEHA TQGCPATEEQ EPRPGVPGEE AGPEGAGPQV EEAAGRVAAA LTWLLGEPVL WLGWRADELL SWKRPLRSLL AFLGANLLFW FLALTPWRVY HLISVMILGR VIMQIIKDMV LSRARGAQLW RSLSESWEVI NSKPDERPRL SHCIAESWMN FSIFLQEMSL FKQQSPGKFC LLVCSVCTFF TILGSYIPGV ILSYLLLLFA FLCPLFKCND IGQKIYSKVK SILLKLDFGI GEYINQKKRE RSEADKEKSH KDDSEIDFSA LCPKISLTVA AKELSVSDTD VSEVSWTDNG TFNLSEGYTP QTDTSDDLDR PSEEVFSRDL SDFPSLENGA GTNDEDELSL GLPTELKTKK QQLNSAHRPS KDRQSAAGLS LPLKSDQALH LMSNLAGDVI TAAMTAAIKD QLEGARQALA QAAPTPGDDT DTEEGDDFEL LDQAELDQIE SELGLTQDQG AEAQQSKKSS GFLSNLLGGH. It is sometimes possible for the material contained within the vial of "Protein FAM134B (Fam134b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.