Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of IRX3 expression in transfected 293T cell line by IRX3 monoclonal antibody (M11), clone 1F11.Lane 1: IRX3 transfected lysate (Predicted MW: 52.1 KDa).Lane 2: Non-transfected lysate.)

Mouse IRX3 Monoclonal Antibody | anti-IRX3 antibody

IRX3 (Iroquois Homeobox 3, IRX-1) (FITC)

Gene Names
IRX3; IRX-1; IRXB1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
IRX3; Monoclonal Antibody; IRX3 (Iroquois Homeobox 3; IRX-1) (FITC); Iroquois Homeobox 3; IRX-1; anti-IRX3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F11
Specificity
Recognizes IRX3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-IRX3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
IRX3 (NP_077312, 123aa-209aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YQFGDPSRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRSRTDEEGNAYGSE
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IRX3 expression in transfected 293T cell line by IRX3 monoclonal antibody (M11), clone 1F11.Lane 1: IRX3 transfected lysate (Predicted MW: 52.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IRX3 expression in transfected 293T cell line by IRX3 monoclonal antibody (M11), clone 1F11.Lane 1: IRX3 transfected lysate (Predicted MW: 52.1 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-IRX3 antibody
IRX3 is a member of the Iroquois homeobox gene family (see IRX1; MIM 606197) and plays a role in an early step of neural development (Bellefroid et al., 1998 [PubMed 9427753]). Members of this family appear to play multiple roles during pattern formation of vertebrate embryos (Lewis et al., 1999 [PubMed 10370142]). [supplied by OMIM]
Product Categories/Family for anti-IRX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
iroquois-class homeodomain protein IRX-3
NCBI Official Synonym Full Names
iroquois homeobox 3
NCBI Official Symbol
IRX3
NCBI Official Synonym Symbols
IRX-1; IRXB1
NCBI Protein Information
iroquois-class homeodomain protein IRX-3
UniProt Protein Name
Iroquois-class homeodomain protein IRX-3
UniProt Gene Name
IRX3
UniProt Synonym Gene Names
IRXB1
UniProt Entry Name
IRX3_HUMAN

NCBI Description

IRX3 is a member of the Iroquois homeobox gene family (see IRX1; MIM 606197) and plays a role in an early step of neural development (Bellefroid et al., 1998 [PubMed 9427753]). Members of this family appear to play multiple roles during pattern formation of vertebrate embryos (Lewis et al., 1999 [PubMed 10370142]).[supplied by OMIM, Aug 2009]

Uniprot Description

IRX3: Transcription factor. Involved in SHH-dependent neural patterning. Together with NKX2-2 and NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class I proteins of neuronal progenitor factors, which are repressed by SHH signals. Involved in the transcriptional repression of MNX1 in non-motor neuron cells. Belongs to the TALE/IRO homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 16q12.2

Cellular Component: axon; cytoplasm; nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: negative regulation of neuron differentiation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; mesoderm development; positive regulation of neuron differentiation; metanephros development

Research Articles on IRX3

Similar Products

Product Notes

The IRX3 irx3 (Catalog #AAA6176690) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's IRX3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IRX3 irx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "IRX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.