Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

FABP4 recombinant protein

Human FABP4

Gene Names
FABP4; aP2; ALBP; AFABP; A-FABP; HEL-S-104
Reactivity
Human
Purity
> 98% by SDS-PAGE & visualized by silver stain
Synonyms
FABP4; Human FABP4; Adipocyte lipid-binding protein; Adipocyte-type fatty acid-binding protein; Fatty acid-binding protein 4; A-FABP; AFABP; FABP4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Reactivity
Human
Purity/Purification
> 98% by SDS-PAGE & visualized by silver stain
Form/Format
Lyophilized
Sequence
Protein Sequence: MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVI TIKSESTFKNTEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDG KSTTIKRKREDDKLVVECVMKGVTSTRVYERALEHHHHHH
Sequence Length
132
Species
Human
Conjugation
His-Tag
Related Product Information for FABP4 recombinant protein
Fatty acid binding protein 4 (FABP4), also known as adipocyte P2 and A FABP (adipocyte FABP), is a FABP family member that is expressed in adipocytes and monocyte derived foam cells. It is a lipid transport protein that binds long chain fatty acid and retinoic acid. Human and mouse FABP4 share a 91% amino acid sequence homology. FABP4 plays an important role in maintaining glucose and lipid homeostasis and has been primarily regarded as an adipocyte- and macrophage-specific protein. However recent studies suggest that it may be more widely expressed. A strong FABP4 expression was found in endothelial cells (ECs) of capillaries and small veins in several mouse and human tissues, including the heart and kidney. FABP4 was also detected in the ECs of mature human placental vessels and infantile hemangiomas, the most common tumor of infancy and ECs. In most of these cases, FABP4 was detected in both the nucleus and cytoplasm. FABP4 mRNA and protein levels were significantly induced in cultured ECs by VEGF-A and bFGF treatment. The effect of VEGF-A on FABP4 expression was inhibited by chemical inhibition or short-hairpin (sh) RNA-mediated knockdown of VEGFR-2 (KDR), whereas the VEGFR1 agonists, PlGF-1 and PlGF-2, had no effect on FABP4 expression. Knockdown of FABP4 in ECs significantly reduced proliferation both under baseline conditions and in response to VEGF and bFGF. Thus, FABP4 emerged as a novel target of the VEGF/VEGFR-2 pathway and a positive regulator of cell proliferation in ECs.
Product Categories/Family for FABP4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,719 Da
NCBI Official Full Name
fatty acid-binding protein, adipocyte
NCBI Official Synonym Full Names
fatty acid binding protein 4, adipocyte
NCBI Official Symbol
FABP4
NCBI Official Synonym Symbols
aP2; ALBP; AFABP; A-FABP; HEL-S-104
NCBI Protein Information
fatty acid-binding protein, adipocyte; fatty acid-binding protein 4; adipocyte lipid-binding protein; epididymis secretory protein Li 104; adipocyte-type fatty acid-binding protein
UniProt Protein Name
Fatty acid-binding protein, adipocyte
UniProt Gene Name
FABP4
UniProt Synonym Gene Names
ALBP; A-FABP; AFABP
UniProt Entry Name
FABP4_HUMAN

NCBI Description

FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008]

Uniprot Description

FABP4: a lipid transport protein that is the predominant fatty acid binding protein found in adipocytes. Also expressed in macrophages. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus. Homodimer. Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. Interacts with PPARG. Monomer. FABP4 knockout mice fed a high-fat and high-calorie diet become obese but develop neither insulin resistance nor diabetes, suggesting that this protein might be a link between obesity and insulin resistance and diabetes. Mice deficient in both FABP4 and ApoE show protection against atherosclerosis when compared with mice deficient only in ApoE. Mice carrying a FABP4 genetic variant exhibit both reduced FABP4 expression and a reduced potential for developing type 2 diabetes and coronary heart disease. A related study in humans indicated a similar pattern, suggesting that FABP4 may be a potential therapeutic target in the treatment of these disorders. Belongs to the calycin superfamily,fatty-acid binding protein (FABP) family.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 8q21

Cellular Component: cytoplasm; lipid particle; nucleus

Molecular Function: transporter activity; fatty acid binding

Biological Process: cholesterol homeostasis; transport; white fat cell differentiation; triacylglycerol catabolic process; brown fat cell differentiation; cytokine production; negative regulation of protein kinase activity; negative regulation of transcription, DNA-dependent; positive regulation of inflammatory response

Research Articles on FABP4

Similar Products

Product Notes

The FABP4 fabp4 (Catalog #AAA692237) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human FABP4 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Protein Sequence: MCDAFVGTWK LVSSENFDDY MKEVGVGFAT RKVAGMAKPN MIISVNGDVI TIKSESTFKN TEISFILGQE FDEVTADDRK VKSTITLDGG VLVHVQKWDG KSTTIKRKRE DDKLVVECVM KGVTSTRVYE RALEHHHHHH. It is sometimes possible for the material contained within the vial of "FABP4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.