Mouse anti-Human ITGB7 Monoclonal Antibody | anti-ITGB7 antibody

ITGB7 (Integrin B7, Integrin beta-7, Gut Homing Receptor beta Subunit) APC

Cat. Num. AAA6137229

• Reactivity: Human
• Applications: ELISA, Immunofluorescence
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ITGB7; Monoclonal Antibody; ITGB7 (Integrin B7; Integrin beta-7; Gut Homing Receptor beta Subunit) APC; anti-ITGB7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 8D3
• Specificity: Recognizes human ITGB7.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 798

• Applicable Applications for anti-ITGB7 antibody: ELISA (EIA), Immunofluorescence (IF)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa401-505 from human ITGB7 (NP_000880) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCSDGQGHLQCGVCSCAPG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ITGB7 on HeLa cell. [antibody concentration 10ug/ml])

Product Categories/Family for anti-ITGB7 antibody

Antibodies; Integrin

NCBI and Uniprot Product Information

• NCBI GI #: 4504777
• NCBI GeneID: 3695
• NCBI Accession #: NP_000880
• NCBI GenBank Nucleotide #: NM_000889
• UniProt Accession #: P26010
• NCBI Official Full Name: integrin beta-7
• NCBI Official Synonym Full Names: integrin subunit beta 7
• NCBI Official Symbol: ITGB7
• NCBI Protein Information: integrin beta-7
• UniProt Protein Name: Integrin beta-7
• Protein Family: Integrin
• UniProt Gene Name: ITGB7

NCBI Description

This gene encodes a protein that is a member of the integrin superfamily. Members of this family are adhesion receptors that function in signaling from the extracellular matrix to the cell. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. The encoded protein forms dimers with an alpha4 chain or an alphaE chain and plays a role in leukocyte adhesion. Dimerization with alpha4 forms a homing receptor for migration of lymphocytes to the intestinal mucosa and Peyer's patches. Dimerization with alphaE permits binding to the ligand epithelial cadherin, a calcium-dependent adhesion molecule. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq, Sep 2013]

Uniprot Description

ITGB7: integrin alpha-4/beta-7 (Peyer's patches-specific homing receptor lpam-1) is expected to play a role in adhesive interactions of leukocytes. It is a receptor for fibronectin and recognizes one or more domains within the alternatively spliced CS-1 region of fibronectin. Integrin alpha-4/beta-7 is also a receptor for MADCAM1 and VCAM1. It recognizes the sequence L-D-T in MADCAM 1. Integrin alpha-e/beta-7 (HML-1) is a receptor for e-cadherin. Two alternatively spliced isoforms have been described.

Protein type: Cell adhesion; Membrane protein, integral; Motility/polarity/chemotaxis; Receptor, misc.

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: cell surface; integrin complex; membrane; plasma membrane; receptor complex

Molecular Function: cell adhesion molecule binding; protein binding

Biological Process: cell adhesion; cell-matrix adhesion; extracellular matrix organization and biogenesis; heterotypic cell-cell adhesion; integrin-mediated signaling pathway; leukocyte tethering or rolling; receptor clustering; regulation of immune response