Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human ER beta/NR3A2 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

ER beta/NR3A2 Recombinant Protein | ER-Beta recombinant protein

Recombinant Human ER beta/NR3A2 Protein

Gene Names
ESR2; Erb; ESRB; ODG8; ESTRB; NR3A2; ER-BETA; ESR-BETA
Purity
>95% by SDS-PAGE.
Synonyms
ER beta/NR3A2; Recombinant Human ER beta/NR3A2 Protein; Estrogen Receptor Beta; Nuclear Receptor Subfamily 3 Group A Member 2; ESR2; ESTRB; NR3A2; ER-Beta recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 50mM TrisHCl, pH8.0.
Sequence
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRV
Sequence Length
495
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the N-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human ER beta/NR3A2 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human ER beta/NR3A2 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for ER-Beta recombinant protein
Description: Recombinant Human ER beta/NR3A2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ala323) of human ER beta/NR3A2 (Accession #Q92731-3) fused with a 6xHis tag at the N-terminus.

Background: Estrogen Receptor Beta (ESR2) is a nuclear protein that belongs to the nuclear hormone receptor family of NR3subfamily. It contains one nuclear receptor DNA-binding domain and is expressed in many tissues at a lowerlevel. ESR2 is a nuclear hormone receptor. It binds estrogens with an affinity similar to that of ESR1 andactivates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependentmanner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while inthe presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature ismore gradual.
Product Categories/Family for ER-Beta recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
estrogen receptor beta isoform 2
NCBI Official Synonym Full Names
estrogen receptor 2
NCBI Official Symbol
ESR2
NCBI Official Synonym Symbols
Erb; ESRB; ODG8; ESTRB; NR3A2; ER-BETA; ESR-BETA
NCBI Protein Information
estrogen receptor beta
UniProt Protein Name
Estrogen receptor beta
UniProt Gene Name
ESR2
UniProt Synonym Gene Names
ESTRB; NR3A2; ER-beta
UniProt Entry Name
ESR2_HUMAN

NCBI Description

This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

ER-beta: a nuclear hormone receptor and transcription factor. Binds and activated by estrogen. Regulates gene expression and affects cellular proliferation and differentiation in target tissues. Binds estrogens with an affinity similar to that of ER-alpha, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. Eight alternatively-spliced isoforms have been described. Isoform beta-cx lacks ligand binding ability and has no or only very low ERE binding activity resulting in the loss of ligand-dependent transactivation ability.

Protein type: DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 14q23.2

Cellular Component: nucleoplasm; mitochondrion; extracellular region; nucleus

Molecular Function: ligand-dependent nuclear receptor activity; receptor antagonist activity; protein binding; estrogen receptor activity; enzyme binding; DNA binding; zinc ion binding; transcription coactivator activity; estrogen response element binding; steroid hormone receptor activity; transcription factor activity; steroid binding

Biological Process: transcription initiation from RNA polymerase II promoter; estrogen receptor signaling pathway; induction of apoptosis by hormones; neuron migration; vagina development; negative regulation of transcription from RNA polymerase II promoter; uterus development; signal transduction; cell-cell signaling; ovarian follicle development; regulation of transcription, DNA-dependent; steroid hormone mediated signaling; positive regulation of transcription factor activity; gene expression; brain development; negative regulation of cell growth; negative regulation of epithelial cell proliferation

Research Articles on ER-Beta

Similar Products

Product Notes

The ER-Beta esr2 (Catalog #AAA9140041) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MDIKNSPSSL NSPSSYNCSQ SILPLEHGSI YIPSSYVDSH HEYPAMTFYS PAVMNYSIPS NVTNLEGGPG RQTTSPNVLW PTPGHLSPLV VHRQLSHLYA EPQKSPWCEA RSLEHTLPVN RETLKRKVSG NRCASPVTGP GSKRDAHFCA VCSDYASGYH YGVWSCEGCK AFFKRSIQGH NDYICPATNQ CTIDKNRRKS CQACRLRKCY EVGMVKCGSR RERCGYRLVR RQRSADEQLH CAGKAKRSGG HAPRV. It is sometimes possible for the material contained within the vial of "ER beta/NR3A2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.