Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Estrogen receptor beta (ESR2) Recombinant Protein | ESR2 recombinant protein

Recombinant Human Estrogen receptor beta (ESR2), partial

Gene Names
ESR2; Erb; ESRB; ESTRB; NR3A2; ER-BETA; ESR-BETA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Estrogen receptor beta (ESR2); Recombinant Human Estrogen receptor beta (ESR2); partial; Nuclear receptor subfamily 3 group A member 2; ESR2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-323aa
Sequence
DIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA
Sequence Length
Partial of Isoform 3
Organism
Homo sapiens (Human)
Tag Information
N-terminal 6xHis-SUMO-tagged
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C.
The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

SDS-Page
Related Product Information for ESR2 recombinant protein
Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560). Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.
Product Categories/Family for ESR2 recombinant protein
References
Repression of estrogen receptor beta function by putative tumor suppressor DBC1.Koyama S., Wada-Hiraike O., Nakagawa S., Tanikawa M., Hiraike H., Miyamoto Y., Sone K., Oda K., Fukuhara H., Nakagawa K., Kato S., Yano T., Taketani Y.Biochem. Biophys. Res. Commun. 392:357-362 (2010)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51.9 kDa
NCBI Official Full Name
estrogen receptor beta isoform 2
NCBI Official Synonym Full Names
estrogen receptor 2
NCBI Official Symbol
ESR2
NCBI Official Synonym Symbols
Erb; ESRB; ESTRB; NR3A2; ER-BETA; ESR-BETA
NCBI Protein Information
estrogen receptor beta
UniProt Protein Name
Estrogen receptor beta
Protein Family
UniProt Gene Name
ESR2
UniProt Synonym Gene Names
ESTRB; NR3A2; ER-beta

NCBI Description

This gene encodes a member of the family of estrogen receptors and superfamily of nuclear receptor transcription factors. The gene product contains an N-terminal DNA binding domain and C-terminal ligand binding domain and is localized to the nucleus, cytoplasm, and mitochondria. Upon binding to 17beta-estradiol or related ligands, the encoded protein forms homo- or hetero-dimers that interact with specific DNA sequences to activate transcription. Some isoforms dominantly inhibit the activity of other estrogen receptor family members. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560). Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.

Research Articles on ESR2

Similar Products

Product Notes

The ESR2 esr2 (Catalog #AAA7110848) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-323aa with tag N-terminal 6xHis-SUMO-tagged. The amino acid sequence is listed below: DIKNSPSSLN SPSSYNCSQS ILPLEHGSIY IPSSYVDSHH EYPAMTFYSP AVMNYSIPSN VTNLEGGPGR QTTSPNVLWP TPGHLSPLVV HRQLSHLYAE PQKSPWCEAR SLEHTLPVNR ETLKRKVSGN RCASPVTGPG SKRDAHFCAV CSDYASGYHY GVWSCEGCKA FFKRSIQGHN DYICPATNQC TIDKNRRKSC QACRLRKCYE VGMVKCGSRR ERCGYRLVRR QRSADEQLHC AGKAKRSGGH APRVRELLLD ALSPEQLVLT LLEAEPPHVL ISRPSAPFTE ASMMMSLTKL ADKELVHMIS WAKKIPGMRG NA. It is sometimes possible for the material contained within the vial of "Estrogen receptor beta (ESR2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.