Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Envelope glycoprotein gp130 (env) Recombinant Protein | env recombinant protein

Recombinant Simian foamy virus type 3 Envelope glycoprotein gp130 (env)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Envelope glycoprotein gp130 (env); Recombinant Simian foamy virus type 3 Envelope glycoprotein gp130 (env); Recombinant Envelope glycoprotein gp130 (env); Envelope glycoprotein gp130; Env polyprotein Cleaved into the following 3 chains: 1. Leader peptide; 2. LP; Env leader protein; Elp gp18LP Surface protein; SU; Glycoprotein 80; gp80 Transmembrane protein; TM;; env recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
567-982
Sequence
RSTNIEKLRSMGYSLTGAVQTLSQISDINDERLQQGVSLLRDHVVTLMEAALHDITIMEGMLAIQHVHTHLNHLKTILLMRKIDWTFIKSNWIKEQLQKTEDEMKIIRRTAKSLVYYVTQTSSSTTATSWEIGIYYEITIPKHIYLNNWQVINIGHLVESAGHLTLIRVKHPYEVINKECTYEQYLHLEDCISQDYVICDTVQIVSPCGNSTTTSDCPVTAEKVKEPYVQVSALKNGSYLVLTSRTDCSIPAYVPSIVTVNETVKCFGVEFHKPLYSESKVSFEPQVPHLKLRLPHLVGIIANLQNLEIEVTSTQESIKDQIERAKSQLLRLDIHEGDFPAWIQQLASATRDVWPAAARALQGIGNVLSNTAQGIFGTTVSILSYAKPILIGIGVILLIAFLFKIVSWLPGKKKRN
Sequence Length
982
Species
Simian foamy virus type 3 (strain LK3) (SFVagm) (SFV-3)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
113,314 Da
NCBI Official Full Name
Env
NCBI Official Symbol
env
NCBI Protein Information
Env; envelope
UniProt Protein Name
Envelope glycoprotein gp130
Protein Family
UniProt Gene Name
env
UniProt Synonym Gene Names
LP; Elp; SU; gp80; TM; gp48
UniProt Entry Name
ENV_SFV3L

Uniprot Description

Function: The surface protein (SU) attaches the virus to the host cell by binding to the cell receptor. This interaction triggers the refolding of TM and is thought to activate its fusogenic potential by unmasking its fusion peptide

By similarity.The transmembrane protein (TM) acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Membranes fusion leads to delivery of the nucleocapsid into the cytoplasm

By similarity.The leader peptide is a component of released, infectious virions and is required for particle budding

By similarity.

Subunit structure: The mature envelope protein consists of a trimer of SU-TM heterodimers. The N-terminus of leader peptide specifically interacts with Gag protein. This specific interaction between Gag protein and Env glycoprotein may allow particle egress

By similarity.

Subcellular location: Envelope glycoprotein gp130: Host endoplasmic reticulum membrane. Note: The polyprotein has a highly unusual biosynthesis for a retroviral glycoprotein. It is translated as a full-length precursor protein into the rough endoplasmic reticulum and initially has a type III protein configuration with both its N and C-termini located intracytoplasmically

By similarity.Leader peptide: Virion membrane; Single-pass type II membrane protein

By similarity. Host endoplasmic reticulum membrane; Single-pass type II membrane protein

By similarity. Note: Its N-terminus is located inside the viral particle

By similarity.Transmembrane protein: Virion membrane; Single-pass type I membrane protein

By similarity. Host endoplasmic reticulum membrane; Single-pass type I membrane protein

By similarity. Surface protein: Virion membrane; Peripheral membrane protein

By similarity. Host endoplasmic reticulum membrane; Peripheral membrane protein

By similarity. Note: The surface protein is not anchored to the viral envelope, but associates with the extravirion surface through its binding to TM

By similarity.

Domain: The ER retention signal plays an important role in establishing the intracellular site of budding

By similarity.

Post-translational modification: Envelope glycoproteins are synthesized as a inactive precursor that is processed by host furin or a furin-like protease to yield a functional hetero-oligomeric complex

By similarity.The transmembrane protein and the surface protein are N-glycosylated

By similarity.Mono- and polyubiquitinated leader peptide are found in viral particles. Ubiquitination may be involved in regulating the balance between viral and subviral particles release

By similarity.

Miscellaneous: Foamy viruses are distinct from other retroviruses in many respects. Their protease is active as an uncleaved Pro-Pol protein. Mature particles do not include the usual processed retroviral structural protein (MA, CA and NC), but instead contain two large Gag proteins. Their functional nucleic acid appears to be either RNA or dsDNA (up to 20% of extracellular particles), because they probably proceed either to an early (before integration) or late reverse transcription (after assembly). Foamy viruses have the ability to retrotranspose intracellularly with high efficiency. They bud predominantly into the endoplasmic reticulum (ER) and occasionally at the plasma membrane. Budding requires the presence of Env proteins. Most viral particles probably remain within the infected cell.

Sequence caution: The sequence AAA47798.1 differs from that shown. Reason: Erroneous initiation.

Similar Products

Product Notes

The env env (Catalog #AAA1259049) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 567-982. The amino acid sequence is listed below: RSTNIEKLRS MGYSLTGAVQ TLSQISDIND ERLQQGVSLL RDHVVTLMEA ALHDITIMEG MLAIQHVHTH LNHLKTILLM RKIDWTFIKS NWIKEQLQKT EDEMKIIRRT AKSLVYYVTQ TSSSTTATSW EIGIYYEITI PKHIYLNNWQ VINIGHLVES AGHLTLIRVK HPYEVINKEC TYEQYLHLED CISQDYVICD TVQIVSPCGN STTTSDCPVT AEKVKEPYVQ VSALKNGSYL VLTSRTDCSI PAYVPSIVTV NETVKCFGVE FHKPLYSESK VSFEPQVPHL KLRLPHLVGI IANLQNLEIE VTSTQESIKD QIERAKSQLL RLDIHEGDFP AWIQQLASAT RDVWPAAARA LQGIGNVLSN TAQGIFGTTV SILSYAKPIL IGIGVILLIA FLFKIVSWLP GKKKRN. It is sometimes possible for the material contained within the vial of "Envelope glycoprotein gp130 (env), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.