Probable protease eep (eep) Recombinant Protein | eep recombinant protein
Recombinant Enterococcus faecalis Probable protease eep (eep)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable protease eep (eep); Recombinant Enterococcus faecalis Probable protease eep (eep); eep recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-422aa; full length protein
Sequence
MKTIITFIIVFGILVLVHEFGHFYFAKRAGILVREFAIGMGPKIFAHRGKDGTTYTIRLL PIGGYVRMAGMGEDMTEITPGMPLSVELNAVGNVVKINTSKKVQLPHSIPMEVIDFDLEK ELFIKGYVNGNEEEETVYKVDHDATIIESDGTEVRIAPLDVQFQSAKLSQRILTNFAGPM NNFILGFILFTLAVFLQGGVTDLNTNQIGQVIPNGPAAEAGLKENDKVLSINNQKIKKYE DFTTIVQKNPEKPLTFVVERNGKEEQLTVTPEKQKVEKQTIGKVGVYPYMKTDLPSKLMG GIQDTLNSTTQIFKALGSLFTGFSLNKLGGPVMMFKLSEEASNAGVSTVVFLMAMLSMNL GIINLLPIPALDGGKIVLNIIEGVRGKPISPEKEGIITLIGFGFVMVLMVLVTWNDIQRF FF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Enterococcus faecalis (strain ATCC 700802 / V583)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for eep recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,500 Da
NCBI Official Full Name
membrane-associated zinc metalloprotease
NCBI Official Symbol
EF2380
NCBI Protein Information
membrane-associated zinc metalloprotease
UniProt Protein Name
Probable protease eep
Protein Family
UniProt Gene Name
eep
UniProt Entry Name
EEP_ENTFA
Uniprot Description
Involved in production of the peptide pheromone cAD1.
Similar Products
Product Notes
The eep eep (Catalog #AAA7014172) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-422aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the eep eep for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKTIITFIIV FGILVLVHEF GHFYFAKRAG ILVREFAIGM GPKIFAHRGK DGTTYTIRLL PIGGYVRMAG MGEDMTEITP GMPLSVELNA VGNVVKINTS KKVQLPHSIP MEVIDFDLEK ELFIKGYVNG NEEEETVYKV DHDATIIESD GTEVRIAPLD VQFQSAKLSQ RILTNFAGPM NNFILGFILF TLAVFLQGGV TDLNTNQIGQ VIPNGPAAEA GLKENDKVLS INNQKIKKYE DFTTIVQKNP EKPLTFVVER NGKEEQLTVT PEKQKVEKQT IGKVGVYPYM KTDLPSKLMG GIQDTLNSTT QIFKALGSLF TGFSLNKLGG PVMMFKLSEE ASNAGVSTVV FLMAMLSMNL GIINLLPIPA LDGGKIVLNI IEGVRGKPIS PEKEGIITLI GFGFVMVLMV LVTWNDIQRF FF. It is sometimes possible for the material contained within the vial of "Probable protease eep (eep), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
