EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3) Recombinant Protein | EDIL3 recombinant protein
Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3)
Gene Names
EDIL3; DEL1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3); Recombinant Human EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3); EDIL3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-480, Full length protein
Sequence
DICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Sequence Length
457
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for EDIL3 recombinant protein
This protein is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52,748 Da
NCBI Official Full Name
EGF-like repeat and discoidin I-like domain-containing protein 3 isoform 2
NCBI Official Synonym Full Names
EGF like repeats and discoidin domains 3
NCBI Official Symbol
EDIL3
NCBI Official Synonym Symbols
DEL1
NCBI Protein Information
EGF-like repeat and discoidin I-like domain-containing protein 3
UniProt Protein Name
EGF-like repeat and discoidin I-like domain-containing protein 3
UniProt Gene Name
EDIL3
UniProt Synonym Gene Names
DEL1
NCBI Description
The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq, Jul 2008]
Uniprot Description
Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development.
Research Articles on EDIL3
Similar Products
Product Notes
The EDIL3 edil3 (Catalog #AAA1068025) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-480, Full length protein. The amino acid sequence is listed below: DICDPNPCEN GGICLPGLAD GSFSCECPDG FTDPNCSSVV EVASDEEEPT SAGPCTPNPC HNGGTCEISE AYRGDTFIGY VCKCPRGFNG IHCQHNINEC EVEPCKNGGI CTDLVANYSC ECPGEFMGRN CQYKCSGPLG IEGGIISNQQ ITASSTHRAL FGLQKWYPYY ARLNKKGLIN AWTAAENDRW PWIQINLQRK MRVTGVITQG AKRIGSPEYI KSYKIAYSND GKTWAMYKVK GTNEDMVFRG NIDNNTPYAN SFTPPIKAQY VRLYPQVCRR HCTLRMELLG CELSGCSEPL GMKSGHIQDY QITASSIFRT LNMDMFTWEP RKARLDKQGK VNAWTSGHND QSQWLQVDLL VPTKVTGIIT QGAKDFGHVQ FVGSYKLAYS NDGEHWTVYQ DEKQRKDKVF QGNFDNDTHR KNVIDPPIYA RHIRILPWSW YGRITLRSEL LGCTEEE. It is sometimes possible for the material contained within the vial of "EGF-like repeat and discoidin I-like domain-containing protein 3 (EDIL3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
