Ectodysplasin-A receptor-associated adapter protein (EDARADD) Recombinant Protein | EDARADD recombinant protein

Recombinant Human Ectodysplasin-A receptor-associated adapter protein (EDARADD)

Cat. Num. AAA1418955

• Gene Names: EDARADD; ED3; EDA3; ECTD11A; ECTD11B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ectodysplasin-A receptor-associated adapter protein (EDARADD); Recombinant Human Ectodysplasin-A receptor-associated adapter protein (EDARADD); EDARADD recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-215, Full length protein
• Sequence: MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF
• Sequence Length: 215

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for EDARADD recombinant protein

This gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defective development of hair, teeth, and eccrine sweat glands. This protein is a death domain-containing protein, and is found to interact with EDAR, a death domain receptor known to be required for the development of hair, teeth and other ectodermal derivatives. This protein and EDAR are coexpressed in epithelial cells during the formation of hair follicles and teeth. Through its interaction with EDAR, this protein acts as an adaptor, and links the receptor to downstream signaling pathways. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

NCBI and Uniprot Product Information

• NCBI GI #: 18152769
• NCBI GeneID: 128178
• NCBI Accession #: NP_542776.1
• NCBI GenBank Nucleotide #: NM_080738.3
• UniProt Accession #: Q8WWZ3; Q5VYJ7; A2VCK5; A8K7B5; B1AL54; B9ZVW5
• Molecular Weight: 23,690 Da
• NCBI Official Full Name: ectodysplasin-A receptor-associated adapter protein isoform B
• NCBI Official Synonym Full Names: EDAR associated death domain
• NCBI Official Symbol: EDARADD
• NCBI Official Synonym Symbols: ED3; EDA3; ECTD11A; ECTD11B
• NCBI Protein Information: ectodysplasin-A receptor-associated adapter protein
• UniProt Protein Name: Ectodysplasin-A receptor-associated adapter protein
• Protein Family: Ectodysplasin-A receptor-associated adapter protein
• UniProt Gene Name: EDARADD

NCBI Description

This gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defective development of hair, teeth, and eccrine sweat glands. The protein encoded by this gene is a death domain-containing protein, and is found to interact with EDAR, a death domain receptor known to be required for the development of hair, teeth and other ectodermal derivatives. This protein and EDAR are coexpressed in epithelial cells during the formation of hair follicles and teeth. Through its interaction with EDAR, this protein acts as an adaptor, and links the receptor to downstream signaling pathways. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

Adapter protein that interacts with EDAR DEATH domain and couples the receptor to EDA signaling pathway during morphogenesis of ectodermal organs. Mediates the activation of NF-kappa-B.