Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase MIB1 Recombinant Protein | MIB1 recombinant protein

Recombinant human E3 ubiquitin-protein ligase MIB1

Gene Names
MIB1; MIB; DIP1; ZZZ6; DIP-1; LVNC7; ZZANK2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase MIB1; Recombinant human E3 ubiquitin-protein ligase MIB1; Recombinant human E3 ubiquitin-protein ligase MIB1 protein; MIB1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
RNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANYRCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHLRHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTEIQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGNRNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPSGNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQ
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.
Related Product Information for MIB1 recombinant protein
E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis
References
[1] "Mind bomb is a ubiquitin ligase that is essential for efficient activation of Notch signaling by Delta."

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
43 KD
NCBI Official Full Name
E3 ubiquitin-protein ligase MIB1
NCBI Official Synonym Full Names
mindbomb E3 ubiquitin protein ligase 1
NCBI Official Symbol
MIB1
NCBI Official Synonym Symbols
MIB; DIP1; ZZZ6; DIP-1; LVNC7; ZZANK2
NCBI Protein Information
E3 ubiquitin-protein ligase MIB1

Research Articles on MIB1

Similar Products

Product Notes

The MIB1 (Catalog #AAA955619) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: RNNRVMVEGV GARVVRGPDW KWGKQDGGEG HVGTVRSFES PEEVVVVWDN GTAANYRCSG AYDLRILDSA PTGIKHDGTM CDTCRQQPII GIRWKCAECT NYDLCTVCYH GDKHHLRHRF YRITTPGSER VLLESRRKSK KITARGIFAG ARVVRGVDWQ WEDQDGGNGR RGKVTEIQDW SASSPHSAAY VLWDNGAKNL YRVGFEGMSD LKCVQDAKGG SFYRDHCPVL GEQNGNRNPG GLQIGDLVNI DLDLEIVQSL QHGHGGWTDG MFETLTTTGT VCGIDEDHDI VVQYPSGNRW TFNPAVLTKA NIVRSGDAAQ GAEGGTSQ. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase MIB1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.