Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged MIB1 is ~0.1ng/ml as a capture antibody.)

Mouse anti-Human MIB1 Monoclonal Antibody | anti-MIB1 antibody

MIB1 (E3 Ubiquitin-protein Ligase MIB1, DAPK-interacting Protein 1, DIP-1, Mind Bomb Homolog 1, Zinc Finger ZZ Type with Ankyrin Repeat Domain Protein 2, DIP1, KIAA1323, ZZANK2, DKFZp686I0769, DKFZp761M1710, FLJ90676, MGC129659, MGC129660, MIB, ZZZ6) (HRP

Gene Names
MIB1; MIB; DIP1; ZZZ6; DIP-1; LVNC7; ZZANK2
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MIB1; Monoclonal Antibody; MIB1 (E3 Ubiquitin-protein Ligase MIB1; DAPK-interacting Protein 1; DIP-1; Mind Bomb Homolog 1; Zinc Finger ZZ Type with Ankyrin Repeat Domain Protein 2; DIP1; KIAA1323; ZZANK2; DKFZp686I0769; DKFZp761M1710; FLJ90676; MGC129659; MGC129660; MIB; ZZZ6) (HRP; anti-MIB1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A9
Specificity
Recognizes human MIB1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MIB1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa909-1007 from human MIB1 (NP_065825) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged MIB1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MIB1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-MIB1 antibody
E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF-induced apoptosis. Mediates 'Lys-63'-linked polyubiquitination of TBK1, which probably participates in kinase activation.
Product Categories/Family for anti-MIB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 89; 102; 111 kDa

Observed: 103 kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase MIB1
NCBI Official Synonym Full Names
mindbomb E3 ubiquitin protein ligase 1
NCBI Official Symbol
MIB1
NCBI Official Synonym Symbols
MIB; DIP1; ZZZ6; DIP-1; LVNC7; ZZANK2
NCBI Protein Information
E3 ubiquitin-protein ligase MIB1; DAPK-interacting protein 1; ubiquitin ligase mind bomb; zinc finger ZZ type with ankyrin repeat domain protein 2
UniProt Protein Name
E3 ubiquitin-protein ligase MIB1
UniProt Gene Name
MIB1
UniProt Synonym Gene Names
DIP1; KIAA1323; ZZANK2; DIP-1
UniProt Entry Name
MIB1_HUMAN

NCBI Description

This gene encodes a protein containing multiple ankyrin repeats and RING finger domains that functions as an E3 ubiquitin ligase. The encoded protein positively regulates Notch signaling by ubiquitinating the Notch receptors, thereby facilitating their endocytosis. This protein may also promote the ubiquitination and degradation of death-associated protein kinase 1 (DAPK1). [provided by RefSeq, Jun 2013]

Uniprot Description

MIB1: E3 ubiquitin-protein ligase that mediates ubiquitination of Delta receptors, which act as ligands of Notch proteins. Positively regulates the Delta-mediated Notch signaling by ubiquitinating the intracellular domain of Delta, leading to endocytosis of Delta receptors. Probably mediates ubiquitination and subsequent proteasomal degradation of DAPK1, thereby antagonizing anti-apoptotic effects of DAPK1 to promote TNF- induced apoptosis. Mediates 'Lys-63'-linked polyubiquitination of TBK1, which probably participates in kinase activation. Widely expressed at low level. Expressed at higher level in spinal cord, ovary, whole brain, and all specific brain regions examined.

Protein type: Ubiquitin conjugating system; EC 6.3.2.-; EC 6.3.2.19; Ubiquitin ligase; Ligase

Chromosomal Location of Human Ortholog: 18q11.2

Cellular Component: centrosome; postsynaptic density; cytoplasm; plasma membrane; cytoplasmic vesicle; cytosol

Molecular Function: protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: blood vessel development; somitogenesis; negative regulation of neuron differentiation; Notch signaling pathway; in utero embryonic development; protein ubiquitination; positive regulation of endocytosis; endocytosis; heart looping; neural tube formation

Disease: Left Ventricular Noncompaction 7

Research Articles on MIB1

Similar Products

Product Notes

The MIB1 mib1 (Catalog #AAA6153531) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MIB1 (E3 Ubiquitin-protein Ligase MIB1, DAPK-interacting Protein 1, DIP-1, Mind Bomb Homolog 1, Zinc Finger ZZ Type with Ankyrin Repeat Domain Protein 2, DIP1, KIAA1323, ZZANK2, DKFZp686I0769, DKFZp761M1710, FLJ90676, MGC129659, MGC129660, MIB, ZZZ6) (HRP reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MIB1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MIB1 mib1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MIB1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.