Ciliary Neurotrophic Factor Active Protein | rCNTF active protein
Recombinant Rat Ciliary Neurotrophic Factor
Purity
Greater than 99.0% as determined by: (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Synonyms
Ciliary Neurotrophic Factor; Recombinant Rat Ciliary Neurotrophic Factor; CNTF Rat; Ciliary Neurotrophic Factor Rat Recombinant; HCNTF; CNTF; rCNTF active protein
Host
E Coli
Purity/Purification
Greater than 99.0% as determined by: (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Form/Format
Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Sequence Length
200
Solubility
It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100 ug/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Biological Activity
Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Preparation and Storage
Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution CNTF should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.Please prevent freeze-thaw cycles.
Related Product Information for rCNTF active protein
Description: CNTF Recombinant Rat produced in E Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.
Introduction: CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. In addition to the predominant monocistronic transcript originating from this locus, the gene is also co-transcribed with the upstream ZFP91 gene. Co-transcription from the two loci results in a transcript that contains a complete coding region for the zinc finger protein but lacks a complete coding region for ciliary neurotrophic factor.CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
Introduction: CNTF is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. In addition to the predominant monocistronic transcript originating from this locus, the gene is also co-transcribed with the upstream ZFP91 gene. Co-transcription from the two loci results in a transcript that contains a complete coding region for the zinc finger protein but lacks a complete coding region for ciliary neurotrophic factor.CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
Product Categories/Family for rCNTF active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,854 Da
NCBI Official Full Name
ciliary neurotrophic factor
NCBI Official Synonym Full Names
ciliary neurotrophic factor
NCBI Official Symbol
Cntf
NCBI Protein Information
ciliary neurotrophic factor; ciliary neurotropic factor
UniProt Protein Name
Ciliary neurotrophic factor
Protein Family
UniProt Gene Name
Cntf
UniProt Synonym Gene Names
CNTF
UniProt Entry Name
CNTF_RAT
NCBI Description
a cytokine involved in neuronal degeneration and adipocyte gene expression [RGD, Feb 2006]
Uniprot Description
CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
Research Articles on rCNTF
Similar Products
Product Notes
The rCNTF cntf (Catalog #AAA143807) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: AFAEQTPLTL HRRDLSSRSI WLARKIRSDL TALMESYVKH QGLNKNINLD SVDGVPVAST DRWSEMTEAE RLQENLQAYR TFQGMLTKLL EDQRVHFTPT EGDFHQAIHT LMLQVSAFAY QLEELMVLLE QKIPENEADG MPATVGDGGL FEKKLWGLKV LQELSQWTVR SIHDLRVISS HQMGISALES HYGAKDKQM. It is sometimes possible for the material contained within the vial of "Ciliary Neurotrophic Factor, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
