Tumor necrosis factor receptor superfamily member 8 (TNFRSF8) Active Protein | TNFRSF8 active protein

Recombinant Human Tumor necrosis factor receptor superfamily member 8 (TNFRSF8), partial (Active)

Cat. Num. AAA9018416

• Gene Names: TNFRSF8; CD30; Ki-1; D1S166E
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor necrosis factor receptor superfamily member 8 (TNFRSF8); Recombinant Human Tumor necrosis factor receptor superfamily member 8 (TNFRSF8); partial (Active); TNFRSF8 active protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 19-379aa, Partial
• Sequence: FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK

• Species: Homo sapiens (Human)
• Endotoxin: Less than 1.0EU/ug as determined by LAL method.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD30 at 5ug/mL can bind human CD30L , the EC50 is 14.96-20.25ng/mL.
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Activity

Product Categories/Family for TNFRSF8 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 597709795
• NCBI GeneID: 943
• NCBI Accession #: NP_001234.3
• NCBI GenBank Nucleotide #: NM_001243.4
• UniProt Accession #: P28908; Q6P4D9; B1AN79; B9EGD9; D3YTD8
• Molecular Weight: 50,935 Da
• NCBI Official Full Name: tumor necrosis factor receptor superfamily member 8 isoform 1
• NCBI Official Synonym Full Names: tumor necrosis factor receptor superfamily member 8
• NCBI Official Symbol: TNFRSF8
• NCBI Official Synonym Symbols: CD30; Ki-1; D1S166E
• NCBI Protein Information: tumor necrosis factor receptor superfamily member 8
• UniProt Protein Name: Tumor necrosis factor receptor superfamily member 8
• Protein Family: Tumor necrosis factor receptor superfamily
• UniProt Gene Name: TNFRSF8
• UniProt Synonym Gene Names: CD30; D1S166E
• UniProt Entry Name: TNR8_HUMAN

Uniprot Description

TNFRSF8: Receptor for TNFSF8/CD30L. May play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Regulates gene expression through activation of NF- kappa-B. 2 isoforms of the human protein are produced by alternative initiation.

Protein type: Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: integral to plasma membrane

Molecular Function: transmembrane receptor activity; tumor necrosis factor receptor activity

Biological Process: immune response; inflammatory response; multicellular organismal development; negative regulation of cell proliferation; positive regulation of apoptosis; positive regulation of TRAIL biosynthetic process; positive regulation of tumor necrosis factor biosynthetic process; response to lipopolysaccharide; signal transduction