Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C) Active Protein | TNFRSF13C active protein

Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C), partial

Gene Names
TNFRSF13C; BAFFR; CD268; CVID4; BAFF-R; BROMIX; prolixin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C); Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C); partial; TNFRSF13C active protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyop
Sequence Positions
7-71aa, Partial
Sequence
SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
Species
Human
Tag
C-terminal hFc-DYKDDDDK-tagged
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
18,864 Da
NCBI Official Full Name
BAFF receptor
NCBI Official Synonym Full Names
tumor necrosis factor receptor superfamily, member 13C
NCBI Official Symbol
TNFRSF13C
NCBI Official Synonym Symbols
BAFFR; CD268; CVID4; BAFF-R; BROMIX; prolixin
NCBI Protein Information
tumor necrosis factor receptor superfamily member 13C; BAFF receptor; BLyS receptor 3; B cell-activating factor receptor; B-cell-activating factor receptor
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 13C
UniProt Gene Name
TNFRSF13C
UniProt Synonym Gene Names
BAFFR; BR3; BAFF-R
UniProt Entry Name
TR13C_HUMAN

NCBI Description

B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival. [provided by RefSeq, Jul 2008]

Uniprot Description

BAFF-R: B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response. Defects in TNFRSF13C are the cause of immunodeficiency common variable type 4 (CVID4); also called antibody deficiency due to BAFFR defect. CVID4 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, misc.; Cell cycle regulation; Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 22q13.1-q13.31

Cellular Component: integral to membrane; external side of plasma membrane

Biological Process: B cell costimulation; B cell homeostasis; T cell costimulation; positive regulation of germinal center formation; positive regulation of B cell proliferation; positive regulation of T cell proliferation; positive regulation of interferon-gamma biosynthetic process

Disease: Immunodeficiency, Common Variable, 2; Immunodeficiency, Common Variable, 4

Research Articles on TNFRSF13C

Similar Products

Product Notes

The TNFRSF13C tnfrsf13c (Catalog #AAA7137042) is an Active Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 7-71aa, Partial. The amino acid sequence is listed below: SLRGRDAPAP TPCVPAECFD LLVRHCVACG LLRTPRPKPA GASSPAPRTA LQPQESVGAG AGEAA. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.