Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Tumor necrosis factor ligand superfamily member 9 (TNFSF9) Active Protein | TNFSF9 active protein

Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9), partial (Active)

Gene Names
TNFSF9; CD137L; 4-1BB-L
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor ligand superfamily member 9 (TNFSF9); Recombinant Human Tumor necrosis factor ligand superfamily member 9 (TNFSF9); partial (Active); (4-1BB ligand)(4-1BBL); TNFSF9 active protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
71-254aa, Partial
Sequence
REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Species
Homo sapiens (Human)
Endotoxin
Less than 1.0EU/ug as determined by LAL method.
Relevance
Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized TNFSF9 at 2ug/mL can bind TNFRSF9 , the EC50 is 2.671-3.702ng/mL.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-Page

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

SDS-Page ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Activity

Activity
Product Categories/Family for TNFSF9 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,625 Da
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 9
NCBI Official Synonym Full Names
tumor necrosis factor (ligand) superfamily, member 9
NCBI Official Symbol
TNFSF9
NCBI Official Synonym Symbols
CD137L; 4-1BB-L
NCBI Protein Information
tumor necrosis factor ligand superfamily member 9; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 9
UniProt Gene Name
TNFSF9
UniProt Synonym Gene Names
4-1BBL
UniProt Entry Name
TNFL9_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.[provided by RefSeq, Oct 2008]

Uniprot Description

TNFL9: Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. Belongs to the tumor necrosis factor family.

Protein type: Cell cycle regulation; Membrane protein, integral; Cytokine; Apoptosis

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular space; plasma membrane; integral to membrane

Molecular Function: cytokine activity; tumor necrosis factor receptor binding; receptor binding

Biological Process: cell proliferation; positive regulation of interferon-gamma production; positive regulation of cytotoxic T cell differentiation; cell-cell signaling; apoptosis; positive regulation of interleukin-12 production; positive regulation of interleukin-6 production; immune response; myeloid dendritic cell differentiation; signal transduction; positive regulation of activated T cell proliferation

Research Articles on TNFSF9

Similar Products

Product Notes

The TNFSF9 tnfsf9 (Catalog #AAA9018420) is an Active Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 71-254aa, Partial. The amino acid sequence is listed below: REGPELSPDD PAGLLDLRQG MFAQLVAQNV LLIDGPLSWY SDPGLAGVSL TGGLSYKEDT KELVVAKAGV YYVFFQLELR RVVAGEGSGS VSLALHLQPL RSAAGAAALA LTVDLPPASS EARNSAFGFQ GRLLHLSAGQ RLGVHLHTEA RARHAWQLTQ GATVLGLFRV TPEIPAGLPS PRSE. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor ligand superfamily member 9 (TNFSF9), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.