Tumor necrosis factor ligand superfamily member 9 Recombinant Protein | TNFSF9 recombinant protein

Recombinant Human Tumor necrosis factor ligand superfamily member 9 protein

Cat. Num. AAA949988

• Gene Names: TNFSF9; CD137L; TNLG5A; 4-1BB-L
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor necrosis factor ligand superfamily member 9; Recombinant Human Tumor necrosis factor ligand superfamily member 9 protein; 4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA; CD137; TNFSF9 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 52-254aa; Partial
• Sequence: PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for TNFSF9 recombinant protein

Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.

Product Categories/Family for TNFSF9 recombinant protein

Immunology

References

Molecular and biological characterization of human 4-1BB and its ligand.Alderson M.R., Smith C.A., Tough T.W., Davis-Smith T., Armitage R.J., Falk B., Roux E., Baker E., Sutherland G.R., Din W.S., Goodwin R.G.Eur. J. Immunol. 24:2219-2227(1994) A receptor induced by lymphocyte activation (ILA) a new member of the human nerve-growth-factor/tumor-necrosis-factor receptor family.Schwarz H., Tuckwell J., Lotz M.Gene 134:295-298(1993) Schwarz H.Characterization of human homologue of 4-1BB and its ligand.Zhou Z., Kim S., Hurtado J., Lee Z.H., Kim K.K., Pollok K.E., Kwon B.S.Immunol. Lett. 45:67-73(1995) NIEHS SNPs programThe DNA sequence and biological annotation of human chromosome 1.Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.Nature 441:315-321(2006) Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004) 4-1BB and Ox40 are members of a tumor necrosis factor (TNF) -nerve growth factor receptor subfamily that bind TNF receptor-associated factors and activate nuclear factor kappaB.Arch R.H., Thompson C.B.Mol. Cell. Biol. 18:558-565(1998) CD28-independent, TRAF2-dependent costimulation of resting T cells by 4-1BB ligand.Saoulli K., Lee S.Y., Cannons J.L., Yeh W.C., Santana A., Goldstein M.D., Bangia N., DeBenedette M.A., Mak T.W., Choi Y., Watts T.H.J. Exp. Med. 187:1849-1862(1998) A novel leucine-rich repeat protein (LRR-1) potential involvement in 4-1BB-mediated signal transduction.Jang I.-K., Lee Z.-H., Kim H.-H., Hill J.M., Kim J.-D., Kwon B.S.Mol. Cells 12:304-312(2001) The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 4507609
• NCBI GeneID: 8744
• NCBI Accession #: NP_003802.1
• NCBI GenBank Nucleotide #: NM_003811.3
• UniProt Accession #: P41273; Q2M3S2
• Molecular Weight: 25.3 kDa
• NCBI Official Full Name: tumor necrosis factor ligand superfamily member 9
• NCBI Official Synonym Full Names: tumor necrosis factor superfamily member 9
• NCBI Official Symbol: TNFSF9
• NCBI Official Synonym Symbols: CD137L; TNLG5A; 4-1BB-L
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 9
• UniProt Protein Name: Tumor necrosis factor ligand superfamily member 9
• Protein Family: Tumor necrosis factor ligand superfamily
• UniProt Gene Name: TNFSF9
• UniProt Synonym Gene Names: 4-1BBL
• UniProt Entry Name: TNFL9_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.[provided by RefSeq, Oct 2008]

Uniprot Description

TNFL9: Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. Belongs to the tumor necrosis factor family.

Protein type: Cell cycle regulation; Membrane protein, integral; Cytokine; Apoptosis

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular space; integral to membrane; plasma membrane

Molecular Function: cytokine activity; receptor binding; tumor necrosis factor receptor binding; tumor necrosis factor receptor superfamily binding

Biological Process: apoptosis; cell proliferation; cell-cell signaling; immune response; myeloid dendritic cell differentiation; positive regulation of activated T cell proliferation; positive regulation of cytotoxic T cell differentiation; positive regulation of interferon-gamma production; positive regulation of interleukin-12 production; positive regulation of interleukin-6 production; signal transduction