T-cell antigen CD7 Active Protein | CD7 active protein

Recombinant Human T-cell antigen CD7

Cat. Num. AAA948910

• Gene Names: CD7; GP40; TP41; Tp40; LEU-9
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: T-cell antigen CD7; Recombinant Human T-cell antigen CD7; GP40; T-cell leukemia antigen; T-cell surface antigen Leu-9; TP41; CD7; CD7 active protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 26-180aa; Extracellular Domain
• Sequence: AQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
• Sequence Length: 240

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CD7 active protein

Not yet known.

Product Categories/Family for CD7 active protein

Immunology

References

Molecular cloning of two CD7 (T-cell leukemia antigen)

NCBI and Uniprot Product Information

• NCBI GI #: 5453613
• NCBI GeneID: 924
• NCBI Accession #: NP_006128.1
• NCBI GenBank Nucleotide #: NM_006137.6
• UniProt Accession #: P09564
• Molecular Weight: 18.4 kDa
• NCBI Official Full Name: T-cell antigen CD7
• NCBI Official Synonym Full Names: CD7 molecule
• NCBI Official Symbol: CD7
• NCBI Official Synonym Symbols: GP40; TP41; Tp40; LEU-9
• NCBI Protein Information: T-cell antigen CD7
• UniProt Protein Name: T-cell antigen CD7
• Protein Family: T-cell antigen
• UniProt Gene Name: CD7
• UniProt Entry Name: CD7_HUMAN

NCBI Description

This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq, Jul 2008]

Uniprot Description

CD7: Not yet known.

Protein type: Immunoglobulin superfamily; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q25.2-q25.3

Cellular Component: integral to membrane; membrane; plasma membrane

Molecular Function: receptor activity

Biological Process: adaptive immune response; homeostasis of number of cells within a tissue; immune response; T cell activation; transmembrane receptor protein tyrosine kinase signaling pathway