Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

CD7 recombinant protein

CD7, human recombinant

Gene Names
CD7; GP40; TP41; Tp40; LEU-9
Purity
>=90% by SDS-PAGE
Synonyms
CD7; human recombinant; T-cell antigen CD7; GP40; LEU-9; Tp40; TP41; CD7 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>=90% by SDS-PAGE
Form/Format
Liquid. 1mg/ml in 20mM Tris-HCl buffer (pH8.0) containing 0.4 M Urea and 10% glycerol.
Concentration
1mg/ml (varies by lot)
Sequence
MGSSHHHHHHSSGLVPRGSHMGSAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALP
Gene Source
Human
Endotoxin
<1.0 EU per 1 microgram of protein
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Store at -80 degree C.
Centrifuge the vial prior to opening.
Shipping: Dry Ice
Shelf life: ~12 months

SDS-Page

SDS-Page
Related Product Information for CD7 recombinant protein
T-cell antigen CD7, also known as CD7, is a type I transmembrane glycoprotein that is expressed on pluripotential hemopoietic cells, most human thymocytes and some peripheral blood T cells. The CD7 molecule is absent in a subset of human T cells under certain physiologic conditions. Thus an increase in CD7 negative T cells can be seen in some inflammatory skin disease. Recombinant human CD7 protein, fused to His-tag at N-terminus, was expressed in E Coli.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
924
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,409 Da
NCBI Official Full Name
T-cell antigen CD7
NCBI Official Synonym Full Names
CD7 molecule
NCBI Official Symbol
CD7
NCBI Official Synonym Symbols
GP40; TP41; Tp40; LEU-9
NCBI Protein Information
T-cell antigen CD7; CD7 antigen (p41); T-cell leukemia antigen; T-cell surface antigen Leu-9; p41 protein
UniProt Protein Name
T-cell antigen CD7
Protein Family
UniProt Gene Name
CD7
UniProt Entry Name
CD7_HUMAN

NCBI Description

This gene encodes a transmembrane protein which is a member of the immunoglobulin superfamily. This protein is found on thymocytes and mature T cells. It plays an essential role in T-cell interactions and also in T-cell/B-cell interaction during early lymphoid development. [provided by RefSeq, Jul 2008]

Uniprot Description

CD7: Not yet known.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 17q25.2-q25.3

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: receptor activity

Biological Process: T cell activation; homeostasis of number of cells within a tissue; immune response; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on CD7

Similar Products

Product Notes

The CD7 cd7 (Catalog #AAA847117) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGSSHHHHHH SSGLVPRGSH MGSAQEVQQS PHCTTVPVGA SVNITCSTSG GLRGIYLRQL GPQPQDIIYY EDGVVPTTDR RFRGRIDFSG SQDNLTITMH RLQLSDTGTY TCQAITEVNV YGSGTLVLVT EEQSQGWHRC SDAPPRASAL PAPPTGSALP DPQTASALPD PPAASALP. It is sometimes possible for the material contained within the vial of "CD7, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.