FGF-4 active protein

Mouse FGF-4

Cat. Num. AAA691790

• Gene Names: Fgf4; KS3; hst; Fgfk; Hst1; kFGF; Fgf-4; hst-1; Hstf-1
• Reactivity: Mouse
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: FGF-4; Mouse FGF-4; Recombinant Mouse FGF-4; HBGF-4; Heparin-binding growth factor 4; Kfgf; FGF-4 active protein

• Host: E Coli
• Reactivity: Mouse
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: MGHHHHHHHHHHSSGHIEGRHMAPNGTRHAELGHGWDGLVARSLARLPVA AQPPQAAVRSGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADT RDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEIL LPNNYNAYEAYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL
• Sequence Length: 195

• Buffer: 50 mM MES, 100 mM NaCl
• Preparation and Storage: The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20 degree C. Reconstituted FGF-4 should be stored in working aliquots at -20 degree C. Avoid repeated freeze-thaw cycles.

Testing Data

Testing Data #2

Related Product Information for FGF-4 active protein

FGF4 (fibroblast growth factor4), also known as FGF-K or K-FGF (Kaposi's sarcoma-associated FGF), is a 25 kDa secreted, heparin-binding member of the FGF family. The mouse FGF4 cDNA encodes 202 amino acids (aa) with a 29 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C-terminus. Mature mouse FGF 4 shares 87%, 90%, 87% and 85% aa identity with human, rat, canine and bovine FGF4, respectively. Human FGF4 has been shown to exhibit cross species activity. Expression of FGF4 and its receptors, FGF R1c, 2c, 3c and 4, is spatially and temporally regulated during embryonic development. Its expression in the trophoblast inner cell mass promotes expression of FGF R2, and is required for maintenance of the trophectoderm and primitive endoderm. Later in development, FGF4 works together with FGF8 to mediate the activities of the apical ectodermal ridge, which direct the outgrowth and patterning of vertebrate limbs. FGF4 is proposed to play a physiologically relevant role in human embryonic stem cell self-renewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in vitro. A C-terminally truncated 15 kDa isoform that opposes full length FGF4 and promotes differentiation is endogenously expressed in human embryonic stem cells. FGF4 is mitogenic for fibroblasts and endothelial cells in vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in vivo and has been investigated as therapy for coronary artery disease.

Product Categories/Family for FGF-4 active protein

Cytokines & Growth Factors

References

Hebert JM et al, Dev Biol 138:454, 1990 2. Niswander L and GR Martin, Development 114:755, 192 3. Feldman B et al, Science 267:246, 1995 4. Goldin SN and VE Papaioannou, Genesis 36:40, 2003 5. Sun, X. et al, Nature 418:501, 2002 6. Boulet AM et al, Dev Biol 273:361, 2004 7. Yu K and DM Ornitz, Development 135:483, 2008 8. Mariani FV et al, Nature 453:401, 2008 9. Kunath T et al, Development 134:2895, 2007 10. Mayshar Y et al, Stem Cells 26:767, 2008

NCBI and Uniprot Product Information

• NCBI GI #: 66955870
• NCBI GeneID: 14175
• NCBI Accession #: NP_034332.2
• NCBI GenBank Nucleotide #: NM_010202.5
• UniProt Accession #: P11403; P15657; Q542N0
• Molecular Weight: 21,919 Da
• NCBI Official Full Name: fibroblast growth factor 4
• NCBI Official Synonym Full Names: fibroblast growth factor 4
• NCBI Official Symbol: Fgf4
• NCBI Official Synonym Symbols: KS3; hst; Fgfk; Hst1; kFGF; Fgf-4; hst-1; Hstf-1
• NCBI Protein Information: fibroblast growth factor 4; HBGF-4; K-fibroblast growth factor; heparin-binding growth factor 4
• UniProt Protein Name: Fibroblast growth factor 4
• UniProt Gene Name: Fgf4
• UniProt Synonym Gene Names: Fgf-4; Kfgf; FGF-4; HBGF-4
• UniProt Entry Name: FGF4_MOUSE

Uniprot Description

Function: Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Is essential for survival of the postimplantation mouse embryo. Required for normal limb and cardiac valve development during embryogenesis.

Subunit structure: Interacts with FGFR1, FGFR2, FGFR3 and FGFR4. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors

By similarity.

Subcellular location: Secreted

Potential.

Tissue specificity: Expressed in the blastocyst inner cell mass and later in distinct embryonic tissues.

Sequence similarities: Belongs to the heparin-binding growth factors family.