Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human Leptin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 13 kDa.)

Leptin Active Protein | Lep active protein

Recombinant Human Leptin Protein

Gene Names
LEP; OB; OBS; LEPD
Purity
>92% by SDS-PAGE.
Synonyms
Leptin; Recombinant Human Leptin Protein; Lep active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>92% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of 50mM Tris, 150mM NaCl, pH 8.0.
Sequence
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Sequence Length
167
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured in a cell proliferation assay using BaF3 mouse pro-B cells transfected with human Leptin R. The ED50 for this effect is 0.4-2 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human Leptin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 13 kDa.)

SDS-Page (Recombinant Human Leptin Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 13 kDa.)
Related Product Information for Lep active protein
Description: Recombinant Human Leptin Protein is produced by E. coli expression system. The target protein is expressed with sequence (Val22-Cys167) of human Leptin (Accession #NP_000221.1).

Background: Leptin is one of the most important hormones secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this protein and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This protein has also been linked to type 2 diabetes mellitus development.
Product Categories/Family for Lep active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
leptin
NCBI Official Synonym Full Names
leptin
NCBI Official Symbol
LEP
NCBI Official Synonym Symbols
OB; OBS; LEPD
NCBI Protein Information
leptin
UniProt Protein Name
Leptin
Protein Family
UniProt Gene Name
LEP
UniProt Synonym Gene Names
OB; OBS
UniProt Entry Name
LEP_HUMAN

NCBI Description

This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development. [provided by RefSeq, Aug 2017]

Uniprot Description

leptin: May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass. Defects in LEP may be a cause of obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. Belongs to the leptin family.

Protein type: Secreted; Cell development/differentiation; Hormone; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7q31.3

Cellular Component: extracellular space; cytoplasm; extracellular region

Molecular Function: growth factor activity; peptide hormone receptor binding; hormone activity

Biological Process: circadian rhythm; response to dietary excess; positive regulation of myeloid cell differentiation; regulation of fat cell differentiation; regulation of steroid biosynthetic process; female pregnancy; negative regulation of transcription from RNA polymerase II promoter; glucose homeostasis; negative regulation of appetite; positive regulation of luteinizing hormone secretion; positive regulation of tyrosine phosphorylation of Stat3 protein; response to insulin stimulus; response to vitamin E; positive regulation of MAPKKK cascade; regulation of cholesterol absorption; regulation of blood pressure; positive regulation of cell proliferation; positive regulation of ion transport; placenta development; central nervous system neuron development; positive regulation of cytokine production; cholesterol metabolic process; positive regulation of developmental growth; eating behavior; bile acid metabolic process; glucose metabolic process; adult feeding behavior; ovulation from ovarian follicle; leptin-mediated signaling pathway; negative regulation of vasoconstriction; tyrosine phosphorylation of STAT protein; fatty acid beta-oxidation; glycerol biosynthetic process; insulin secretion; response to hypoxia; energy reserve metabolic process; hormone metabolic process; regulation of gluconeogenesis; positive regulation of follicle-stimulating hormone secretion; positive regulation of insulin receptor signaling pathway; leukocyte tethering or rolling; regulation of insulin secretion; negative regulation of apoptosis

Disease: Leptin Deficiency

Research Articles on Lep

Similar Products

Product Notes

The Lep lep (Catalog #AAA9139631) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: VPIQKVQDDT KTLIKTIVTR INDISHTQSV SSKQKVTGLD FIPGLHPILT LSKMDQTLAV YQQILTSMPS RNVIQISNDL ENLRDLLHVL AFSKSCHLPW ASGLETLDSL GGVLEASGYS TEVVALSRLQ GSLQDMLWQL DLSPGC. It is sometimes possible for the material contained within the vial of "Leptin, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.