Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin 37 Active Protein | IL37 active protein

Recombinant Human Interleukin 37

Gene Names
IL37; FIL1; FIL1Z; IL-1H; IL-37; IL1F7; IL1H4; IL-1F7; IL-1H4; IL1RP1; IL-1RP1; FIL1(ZETA)
Purity
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Synonyms
Interleukin 37; Recombinant Human Interleukin 37; IL37 Human; Interleukin-37 Human Recombinant; Interleukin-37; FIL1 zeta; IL-1X; Interleukin-1 family member 7; IL-1F7; Interleukin-1 homolog 4; IL-1H; IL-1H4; Interleukin-1 zeta; IL-1 zeta; Interleukin-1-related protein; IL-1RP1; Interleukin-23; IL-37; IL37; FIL1Z; IL1F7; IL1H4; IL1RP1; FIL1; FIL1(ZETA); IL37 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Form/Format
IL-37 was lyophilized after extensive dialysis against 20mM Phosphate buffer, pH7.4.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
Sequence Length
218
Solubility
It is recommended to quick spin followed by reconstitution of IL37 in PBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Biological Activity
As measured by its binding ability in a functional ELISA, immobilized IL1F7 at 1 ug/ml (100 ul/well) can bind rhIL-18 R/Fc Chimera with a linear range of 0.015-1 ug/ml.
Preparation and Storage
Lyophilized IL37 although stable at room temperature for 3 weeks, should be stored desiccated below -18 degree C. Upon reconstitution IL-37 should be stored at 4 degree C between 2-7 days and for future use below -18 degree C.Please prevent freeze-thaw cycles.
Related Product Information for IL37 active protein
Description: Interleukin-37 Human Recombinant produced in E Coli is a single, non-glycosylated, Polypeptide chain containing 167 amino acids (Lys27-Asp192) and having a molecular mass of 18.6kDa.The IL37 is purified by proprietary chromatographic techniques.

Introduction: Human interleukin family 1, member 7 (IL1F7) belongs to the interleukin 1 cytokine family. There are 5 alternatively spliced transcript variants encoding distinct isoforms with distinct expression profiles. The longest IL-1F7 transcript, named IL1F7b or IL1F7 isoform 1, encodes a 218 aa residues proprotein and containing a 45 aa propeptide which is cleaved to produce a mature protein. IL1F7b binds to IL18 Rb with low affinity however it doesn't exert any IL18 agonistic or antagonistic effects. IL1F7b also binds IL18BP (interleukin 18 binding protein), which is an inhibitory binding protein of interleukin 18 (IL18), and afterward forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18.
Product Categories/Family for IL37 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,459 Da
NCBI Official Full Name
interleukin-37 isoform 1
NCBI Official Synonym Full Names
interleukin 37
NCBI Official Symbol
IL37
NCBI Official Synonym Symbols
FIL1; FIL1Z; IL-1H; IL-37; IL1F7; IL1H4; IL-1F7; IL-1H4; IL1RP1; IL-1RP1; FIL1(ZETA)
NCBI Protein Information
interleukin-37; FIL1 zeta; IL-1 zeta; IL-1F7b (IL-1H4, IL-1H, IL-1RP1); IL-1X protein; IL1F7 (canonical product IL-1F7b); interleukin 1 family member 7; interleukin 1, zeta; interleukin-1 homolog 4; interleukin-1 superfamily z; interleukin-1-related protein; interleukin-23
UniProt Protein Name
Interleukin-37
Protein Family
UniProt Gene Name
IL37
UniProt Synonym Gene Names
FIL1Z; IL1F7; IL1H4; IL1RP1; IL-1F7; IL-1H; IL-1H4; IL-1 zeta; IL-1RP1; IL-37
UniProt Entry Name
IL37_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine can bind to, and may be a ligand for interleukin 18 receptor (IL18R1/IL-1Rrp). This cytokine also binds to interleukin 18 binding protein (IL18BP), an inhibitory binding protein of interleukin 18 (IL18), and subsequently forms a complex with IL18 receptor beta subunit, and through which it inhibits the activity of IL18. This gene along with eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Five alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

IL37: Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation. Belongs to the IL-1 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Chromosomal Location of Human Ortholog: 2q12-q14.1

Cellular Component: nucleoplasm; extracellular space; cytoplasm; extracellular region; nucleolus; cytosol; nucleus

Molecular Function: interleukin-1 receptor binding; cytokine activity

Biological Process: cytokine and chemokine mediated signaling pathway; immune response; inflammatory response

Research Articles on IL37

Similar Products

Product Notes

The IL37 il37 (Catalog #AAA145042) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MKNLNPKKFS IHDQDHKVLV LDSGNLIAVP DKNYIRPEIF FALASSLSSA SAEKGSPILL GVSKGEFCLY CDKDKGQSHP SLQLKKEKLM KLAAQKESAR RPFIFYRAQV GSWNMLESAA HPGWFICTSC NCNEPVGVTD KFENRKHIEF SFQPVCKAEM SPSEVSD. It is sometimes possible for the material contained within the vial of "Interleukin 37, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.