MPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVP SCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS QCECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQ GRGLELNPDTCRCRKLRR
SDS-PAGE
(SDS-PAGE analysis of recombinant human VEGF-B167 produced in E. coli. Samples were loaded under reducing and non-reducing conditions in 15% SDS-polyacrylamide gel and stained with Coomassie Blue.)
Testing Data
(VEGF-B167 BioLISA using recombinant human soluble Flt-1 for capturing and recombinant human VEGF-B167 as standard. A mouse anti-human VEGF-B antibody in combination with a goat anti-mouse Biotin-conjugated antibody was used for detection.)
NCBI and Uniprot Product Information
Uniprot Description
VEGFB: Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis. Homodimer; disulfide-linked. Can also form heterodimer with VEGF. Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas. Belongs to the PDGF/VEGF growth factor family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Cell cycle regulation; Cytokine; Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 11q13
Cellular Component: extracellular region
Molecular Function: growth factor activity; protein binding
Biological Process: platelet degranulation; response to hypoxia; vascular endothelial growth factor receptor signaling pathway
Similar Products
Product Notes
The VEGF-B167 vegfb (Catalog #AAA692275) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human VEGF-B167 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Result by N-terminal sequencing -MPVSQ MPVSQPDAPG HQRKVVSWID VYTRATCQPR EVVVPLTVEL MGTVAKQLVP SCVTVQRCGG CCPDDGLECV PTGQHQVRMQ ILMIRYPSSQ LGEMSLEEHS QCECRPKKKD SAVKPDSPRP LCPRCTQHHQ RPDPRTCRCR CRRRSFLRCQ GRGLELNPDT CRCRKLRR. It is sometimes possible for the material contained within the vial of "VEGF-B167, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.