Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

I-TAC (CXCL11) active protein

Human I-TAC (CXCL11)

Gene Names
CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
Reactivity
Human
Purity
> 98 % (SDS-PAGE, HPLC)
Synonyms
I-TAC (CXCL11); Human I-TAC (CXCL11); Recombinant Human I-TAC; I-TAC (CXCL11) active protein
Ordering
For Research Use Only!
Host
E Coli
Reactivity
Human
Purity/Purification
> 98 % (SDS-PAGE, HPLC)
Form/Format
Lyophilized
Sequence
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKG QRCLNPKSKQARLIIKKVERKNF
Sequence Length
94
Endotoxin Level
< 0.1 ng per ug of I-TAC
Biological Activity
Determined by its ability to chemoattract IL-2 activated T-cells using a concentration range of 0.1-10.0 ng/ml.
Related Product Information for I-TAC (CXCL11) active protein
Human I-TAC (Interferon-inducible T cell alpha chemoacttractant) is an 8.3 kDa protein containing 73 amino acid residues. I-TAC is a novel non-ELR CXC chemokine. It is regulated by Interferon and has potent chemoattractant activity for IL-2 activated T cells, but not for freshly isolated unstimulated T cells, neutrophils, or monocytes.
Product Categories/Family for I-TAC (CXCL11) active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8.3 kDa
NCBI Official Full Name
C-X-C motif chemokine 11
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 11
NCBI Official Symbol
CXCL11
NCBI Official Synonym Symbols
IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
NCBI Protein Information
C-X-C motif chemokine 11; beta-R1; small inducible cytokine B11; small-inducible cytokine B11; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small inducible cytokine subfamily B (Cys-X-Cys), member 9B
UniProt Protein Name
C-X-C motif chemokine 11
UniProt Gene Name
CXCL11
UniProt Synonym Gene Names
ITAC; SCYB11; SCYB9B; IP-9; I-TAC
UniProt Entry Name
CXL11_HUMAN

NCBI Description

Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.

Subcellular location: Secreted.

Tissue specificity: High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin disorders.

Induction: By IFNG/IFN-gamma and IFNB1/IFN-beta. Induction by IFNG/IFN-gamma is enhanced by TNF in monocytes, dermal fibroblasts and endothelial cells, and by IL1/interleukin-1 in astrocytes.

Sequence similarities: Belongs to the intercrine alpha (chemokine CxC) family.

Mass spectrometry: Molecular mass is 8303 Da from positions 22 - 94. Determined by MALDI. Ref.4

Sequence caution: The sequence AAB17374.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on I-TAC (CXCL11)

Similar Products

Product Notes

The I-TAC (CXCL11) cxcl11 (Catalog #AAA691874) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human I-TAC (CXCL11) reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: FPMFKRGRCL CIGPGVKAVK VADIEKASIM YPSNNCDKIE VIITLKENKG QRCLNPKSKQ ARLIIKKVER KNF. It is sometimes possible for the material contained within the vial of "I-TAC (CXCL11), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.