Mouse anti-Human CAPN3 Monoclonal Antibody | anti-CAPN3 antibody

CAPN3 (Calpain-3, Calpain L3, Calpain p94, Calcium-activated Neutral Proteinase 3, CANP 3, Muscle-specific Calcium-activated Neutral Protease 3, New Calpain 1, nCL-1, NCL1, CANPL3, CANP3) (HRP)

Cat. Num. AAA6151569

• Gene Names: CAPN3; p94; CANP3; LGMD2; nCL-1; CANPL3; LGMD2A
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CAPN3; Monoclonal Antibody; CAPN3 (Calpain-3; Calpain L3; Calpain p94; Calcium-activated Neutral Proteinase 3; CANP 3; Muscle-specific Calcium-activated Neutral Protease 3; New Calpain 1; nCL-1; NCL1; CANPL3; CANP3) (HRP); anti-CAPN3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B2
• Specificity: Recognizes human CAPN3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-CAPN3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa210-309 from human CAPN3 (AAH03169.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged CAPN3 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-CAPN3 antibody

CAPN3, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. The protein is a muscle-specific member of the calpain large subunit family that specifically binds to titin.

Product Categories/Family for anti-CAPN3 antibody

Antibodies; Calpain

NCBI and Uniprot Product Information

• NCBI GI #: 13111992
• NCBI GeneID: 825
• Molecular Weight: 18,246 Da
• NCBI Official Full Name: Homo sapiens calpain 3, (p94), mRNA
• NCBI Official Synonym Full Names: calpain 3
• NCBI Official Symbol: CAPN3
• NCBI Official Synonym Symbols: p94; CANP3; LGMD2; nCL-1; CANPL3; LGMD2A
• NCBI Protein Information: calpain-3
• Protein Family: Calpain

NCBI Description

Calpain, a heterodimer consisting of a large and a small subunit, is a major intracellular protease, although its function has not been well established. This gene encodes a muscle-specific member of the calpain large subunit family that specifically binds to titin. Mutations in this gene are associated with limb-girdle muscular dystrophies type 2A. Alternate promoters and alternative splicing result in multiple transcript variants encoding different isoforms and some variants are ubiquitously expressed. [provided by RefSeq, Jul 2008]