Western Blot (WB)
(Western Blot analysis of FOXH1 expression in transfected 293T cell line by FOXH1 polyclonal antibody. Lane 1: FOXH1 transfected lysate (40.15kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human FOXH1 Polyclonal Antibody | anti-FOXH1 antibody
FOXH1 (Forkhead Box Protein H1, Forkhead Activin Signal Transducer 1, Fast-1, hFAST-1, Forkhead Activin Signal Transducer 2, Fast-2, FAST1, FAST2) (FITC)
Gene Names
FOXH1; FAST1; FAST-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FOXH1; Polyclonal Antibody; FOXH1 (Forkhead Box Protein H1; Forkhead Activin Signal Transducer 1; Fast-1; hFAST-1; Forkhead Activin Signal Transducer 2; Fast-2; FAST1; FAST2) (FITC); anti-FOXH1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FOXH1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
1159
Applicable Applications for anti-FOXH1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FOXH1, aa1-365 (AAI11605.1).
Immunogen Sequence
MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGLAPQSSPVPAGTGNSGEEAVPTPPLPSSERPLWPLCPLPGPTRVEGETVQGGAIGPSTLSPEPRAWPLHLLQGTAVPGGRSSGGHRASLWGQLPTSYLPIYTPNVVMPLAPPPTSCPQCPSTSPAYWGVAPETRGPPGLLCDLDALFQGVPPNKSIYDVWVSHPRDLAAPGPGWLLSWCSL
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of FOXH1 expression in transfected 293T cell line by FOXH1 polyclonal antibody. Lane 1: FOXH1 transfected lysate (40.15kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of FOXH1 expression in transfected 293T cell line by FOXH1 polyclonal antibody. Lane 1: FOXH1 transfected lysate (40.15kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FOXH1 antibody
Forkhead box H1 (FOXH1) is a member of the HNF-3FKH family of transcriptional activators. FOXH1 is a winged helix with two loops on the C-terminal side expressed in all human tissue. FOXH1 is an embryonic transcription regulator and is an essential transcriptional co-activator that binds with SMAD2 to activate activin, and therefore induce the gooseciod (GSC) promoter. After FOXH1 binds to SMAD4, activin response element is activated and TGF-b is stimulated. FOXH1 also interacts with NKX2-5 to form an essential component of anterior heart field development. FOXH1 is associated with complex brain malfunctions due to incomplete cleavage of the prosencephalon, and in developmental delays resulting in facial abnormalities such as cyclopia and severe cleft lip or palate.
Product Categories/Family for anti-FOXH1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Synthetic construct Homo sapiens clone IMAGE:40080553, MGC:133416 FOXH1 protein (FOXH1) mRNA, encodes complete protein
NCBI Official Synonym Full Names
forkhead box H1
NCBI Official Symbol
FOXH1
NCBI Official Synonym Symbols
FAST1; FAST-1
NCBI Protein Information
forkhead box protein H1
Protein Family
NCBI Description
FOXH1 encodes a human homolog of Xenopus forkhead activin signal transducer-1. FOXH1 protein binds SMAD2 and activates an activin response element via binding the DNA motif TGT(G/T)(T/G)ATT. [provided by RefSeq, Jul 2008]
Research Articles on FOXH1
Similar Products
Product Notes
The FOXH1 (Catalog #AAA6378848) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXH1 (Forkhead Box Protein H1, Forkhead Activin Signal Transducer 1, Fast-1, hFAST-1, Forkhead Activin Signal Transducer 2, Fast-2, FAST1, FAST2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FOXH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXH1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
