Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Aminopeptidase N Protein | ANPEP protein

Aminopeptidase N

Gene Names
ANPEP; APN; CD13; LAP1; P150; PEPN; GP150
Applications
ELISA, Western Blot
Purity
>95% by SDS-PAGE
Synonyms
Aminopeptidase N; APN; CD13; PEPN; Alanyl aminopeptidase; Aminopeptidase M; Microsomal aminopeptidase; Myeloid plasma membrane glycoprotein CD13; gp150; AP-M; ANPEP protein
Ordering
Host
E Coli
Purity/Purification
>95% by SDS-PAGE
Form/Format
Liquid
Sequence
CYAQEKNRNAENSATAPTLPGSTSATTATTTPAVDES
Sequence Length
967
Applicable Applications for ANPEP protein
ELISA (EIA), Western Blot (WB), Affinity Purification (AP), Protein Array
Tags
His
Storage Buffer
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole,10%glycerol(PH8.0)
Preparation and Storage
Store at -20 degree C.
Avoid repeated freezing and thawing.
Product Categories/Family for ANPEP protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
290
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109,540 Da
NCBI Official Full Name
aminopeptidase N
NCBI Official Synonym Full Names
alanyl aminopeptidase, membrane
NCBI Official Symbol
ANPEP
NCBI Official Synonym Symbols
APN; CD13; LAP1; P150; PEPN; GP150
NCBI Protein Information
aminopeptidase N
UniProt Protein Name
Aminopeptidase N
Protein Family
UniProt Gene Name
ANPEP
UniProt Synonym Gene Names
APN; CD13; PEPN; AP-N; hAPN; AP-M

NCBI Description

Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. Human aminopeptidase N is a receptor for one strain of human coronavirus that is an important cause of upper respiratory tract infections. Defects in this gene appear to be a cause of various types of leukemia or lymphoma. [provided by RefSeq, Jul 2008]

Uniprot Description

Broad specificity aminopeptidase which plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Also involved in the processing of various peptides including peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. May also be involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells. May have a role in angiogenesis and promote cholesterol crystallization.

Research Articles on ANPEP

Similar Products

Product Notes

The ANPEP anpep (Catalog #AAA2889619) is a Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Aminopeptidase N can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB), Affinity Purification (AP), Protein Array. Researchers should empirically determine the suitability of the ANPEP anpep for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: CYAQEKNRNA ENSATAPTLP GSTSATTATT TPAVDES. It is sometimes possible for the material contained within the vial of "Aminopeptidase N, Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.