Vesicle-Associated Membrane Protein-Associated Protein B/C (VAPB) Active Protein | VAPB active protein

Recombinant Human Vesicle-Associated Membrane Protein-Associated Protein B/C (VAPB), Partial

Cat. Num. AAA7115146

• Gene Names: VAPB; ALS8; VAP-B; VAMP-B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Vesicle-Associated Membrane Protein-Associated Protein B/C (VAPB); Recombinant Human Vesicle-Associated Membrane Protein-Associated Protein B/C (VAPB); Partial; Vesicle-associated membrane protein-associated protein B/C; VAMP-B/VAMP-C; VAMP-associated protein B/C; VAP-B/VAP-C; VAPB active protein

• Host: E Coli
• Specificity: Ubiquitous. Isoform 1 predominates.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
• Sequence Positions: 2-132aa; Partial
• Sequence: AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAKPEDLMDSKLRCVFELPAENDKP
• Sequence Length: 99

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human EphB2 in functional ELISA is less than 20 ug/ml.
• Subcellular Location: Endoplasmic reticulum Membrane, Single-Pass Type IV Membrane Protein
• Protein Families: VAMP-Associated Protein (VAP) (TC 9.B.17) Family
• Classification: Other Recombinant Protein
• Pathway: Cholesterol Metabolism
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for VAPB active protein

Relevance: Vesicle-associated membrane protein-associated protein B/C (VAPB) is presents in mitochondria-associated membranes that are endoplasmic reticulum membrane regions closely apposed to the outer mitochondrial membrane. It can form homodimer, and heterodimer with VAPA. It also interacts with VAMP1, VAMP2, HCV NS5A, NS5B, ZFYVE27 and RMDN3. VAPB participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. It is involved in cellular calcium homeostasis regulation.

Function: Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation.

Product Categories/Family for VAPB active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 307574674
• NCBI GeneID: 9217
• NCBI Accession #: NP_001182606.1
• NCBI GenBank Nucleotide #: NM_001195677.1
• UniProt Accession #: O95292
• Molecular Weight: 16 kDa
• NCBI Official Full Name: vesicle-associated membrane protein-associated protein B/C isoform 2
• NCBI Official Synonym Full Names: VAMP associated protein B and C
• NCBI Official Symbol: VAPB
• NCBI Official Synonym Symbols: ALS8; VAP-B; VAMP-B
• NCBI Protein Information: vesicle-associated membrane protein-associated protein B/C
• UniProt Protein Name: Vesicle-associated membrane protein-associated protein B/C
• Protein Family: Virulence-associated protein
• UniProt Gene Name: VAPB
• UniProt Synonym Gene Names: VAMP-B/VAMP-C; VAMP-associated protein B/C; VAP-B/VAP-C
• UniProt Entry Name: VAPB_HUMAN

NCBI Description

The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking. [provided by RefSeq, Jul 2008]

Uniprot Description

VAPB: Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation. Defects in VAPB are the cause of amyotrophic lateral sclerosis type 8 (ALS8). ALS8 is a familial form of amyotrophic lateral sclerosis, a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of cases leading to familial forms. Defects in VAPB are a cause of spinal muscular atrophy proximal adult autosomal dominant (SMAPAD); also called late-onset spinal muscular atrophy Finkel type. A form of spinal muscular atrophy, a neuromuscular disorder characterized by degeneration of the anterior horn cells of the spinal cord, leading to symmetrical muscle weakness and atrophy. SMAPAD is characterized by proximal muscle weakness that begins in the lower limbs and then progresses to upper limbs, onset in late adulthood (after third decade) and a benign course. Most of the patients remain ambulatory 10 to 40 years after clinical onset. Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: protein binding; enzyme binding; protein homodimerization activity; FFAT motif binding; protein heterodimerization activity; microtubule binding; beta-tubulin binding

Biological Process: endoplasmic reticulum organization and biogenesis; cellular calcium ion homeostasis; ER to Golgi vesicle-mediated transport; unfolded protein response, activation of signaling protein activity; sphingolipid metabolic process; positive regulation of viral genome replication; sphingolipid biosynthetic process; unfolded protein response; virus-host interaction; negative regulation of viral protein levels in host cell

Disease: Spinal Muscular Atrophy, Late-onset, Finkel Type; Amyotrophic Lateral Sclerosis 8