Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tumor Necrosis Factor (Tnf) Active Protein | Tnf active protein

Recombinant Mouse Tumor Necrosis Factor (Tnf), Partial

Gene Names
Tnf; DIF; Tnfa; TNF-a; TNFSF2; Tnlg1f; Tnfsf1a; TNFalpha; TNF-alpha
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor Necrosis Factor (Tnf); Recombinant Mouse Tumor Necrosis Factor (Tnf); Partial; Tumor Necrosis Factor; Cachectin; TNF-Alpha; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF-a; Membrane Form; Soluble Form; Tnf; Tnfa; Tnfsf2; Tnf active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
Sequence Positions
89-235aa; Partial
Sequence
DKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL
Sequence Length
219
Species
Mouse
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cytotoxicity assay using L-929 mouse fibroblast cells is less than 0.08 ng/ml in the presence of the metabolic inhibitor actinomycin D.
Subcellular Location
Cell Membrane, Single-Pass Type II Membrane Protein, SUBCELLULAR LOCATION: Tumor necrosis factor, Membrane form: Membrane, Single-Pass Type II Membrane Protein, SUBCELLULAR LOCATION: Tumor necrosis factor, soluble form: Secreted, SUBCELLULAR LOCATION: C-domain 1: Secreted, SUBCELLULAR LOCATION: C-domain 2: Secreted
Protein Families
Tumor Necrosis Factor Family
Classification
Cytokine
Subdivision
Tumor Necrosis Factor
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Tnf active protein
Relevance: Tumor Necrosis Factor (TNF) is a member of the Tumor Necrosis Factor family. TNF exists as a homotrimer and interacts with SPPL2B. TNF is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. TNF is a key cytokine in the development of several inflammatory disorders. It contributes to the development of type 2 diabetes throught its effects on insulin resistance and fatty acid metabolism.

Function: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.
Product Categories/Family for Tnf active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.4 kDa
NCBI Official Full Name
tumor necrosis factor isoform 2
NCBI Official Synonym Full Names
tumor necrosis factor
NCBI Official Symbol
Tnf
NCBI Official Synonym Symbols
DIF; Tnfa; TNF-a; TNFSF2; Tnlg1f; Tnfsf1a; TNFalpha; TNF-alpha
NCBI Protein Information
tumor necrosis factor
UniProt Protein Name
Tumor necrosis factor
Protein Family
UniProt Gene Name
Tnf
UniProt Synonym Gene Names
Tnfa; Tnfsf2; TNF-a; NTF; ICD1; ICD2
UniProt Entry Name
TNFA_MOUSE

NCBI Description

This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. Members of this family are classified based on primary sequence, function, and structure. This protein is synthesized as a type-II transmembrane protein and is reported to be cleaved into products that exert distinct biological functions. It plays an important role in the innate immune response as well as regulating homeostasis but is also implicated in diseases of chronic inflammation. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]

Uniprot Description

TNF-a: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation. Homotrimer. Interacts with SPPL2B. Belongs to the tumor necrosis factor family.

Protein type: Apoptosis; Cytokine; Membrane protein, integral; Motility/polarity/chemotaxis

Cellular Component: cell surface; external side of plasma membrane; extracellular space; integral to membrane; integral to plasma membrane; intracellular; lipid raft; phagocytic cup; plasma membrane; recycling endosome; secretory granule

Molecular Function: cytokine activity; identical protein binding; protease binding; protein binding; tumor necrosis factor receptor binding

Biological Process: activation of MAPK activity; activation of MAPKKK activity; activation of NF-kappaB transcription factor; apoptosis; calcium-mediated signaling; caspase activation; cell activation; cell proliferation; cellular extravasation; chronic inflammatory response to antigenic stimulus; cortical actin cytoskeleton organization and biogenesis; defense response; defense response to bacterium; defense response to Gram-positive bacterium; detection of mechanical stimulus involved in sensory perception of pain; DNA damage response, signal transduction resulting in induction of apoptosis; extracellular matrix organization and biogenesis; glucose metabolic process; humoral immune response; induction of apoptosis via death domain receptors; inflammatory response; JNK cascade; leukocyte migration; leukocyte tethering or rolling; lipopolysaccharide-mediated signaling pathway; MAPKKK cascade; multicellular organismal development; negative regulation of cell proliferation; negative regulation of cytokine secretion during immune response; negative regulation of endothelial cell proliferation; negative regulation of glucose import; negative regulation of interleukin-6 production; negative regulation of L-glutamate transport; negative regulation of lipid catabolic process; negative regulation of mitotic cell cycle; negative regulation of myelination; negative regulation of myoblast differentiation; negative regulation of osteoblast differentiation; negative regulation of protein complex disassembly; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of viral genome replication; organ morphogenesis; osteoclast differentiation; positive regulation of action potential; positive regulation of apoptosis; positive regulation of caspase activity; positive regulation of cell adhesion; positive regulation of cell proliferation; positive regulation of chemokine biosynthetic process; positive regulation of chemokine production; positive regulation of chronic inflammatory response to antigenic stimulus; positive regulation of cytokine production; positive regulation of cytokine secretion; positive regulation of fever; positive regulation of hair follicle development; positive regulation of heterotypic cell-cell adhesion; positive regulation of humoral immune response mediated by circulating immunoglobulin; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of inflammatory response; positive regulation of interferon-gamma production; positive regulation of interleukin-18 production; positive regulation of interleukin-6 production; positive regulation of interleukin-8 biosynthetic process; positive regulation of interleukin-8 production; positive regulation of JNK activity; positive regulation of JNK cascade; positive regulation of MAP kinase activity; positive regulation of membrane protein ectodomain proteolysis; positive regulation of mitosis; positive regulation of neuron apoptosis; positive regulation of NF-kappaB import into nucleus; positive regulation of NFAT protein import into nucleus; positive regulation of nitric oxide biosynthetic process; positive regulation of osteoclast differentiation; positive regulation of peptidyl-serine phosphorylation; positive regulation of phagocytosis; positive regulation of programmed cell death; positive regulation of protein amino acid phosphorylation; positive regulation of protein complex assembly; positive regulation of protein complex disassembly; positive regulation of protein kinase activity; positive regulation of protein kinase B signaling cascade; positive regulation of protein transport; positive regulation of smooth muscle cell proliferation; positive regulation of synaptic transmission; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; positive regulation of translational initiation by iron; protein import into nucleus, translocation; protein kinase B signaling cascade; receptor biosynthetic process; regulation of cell proliferation; regulation of I-kappaB kinase/NF-kappaB cascade; regulation of immunoglobulin secretion; regulation of insulin secretion; regulation of osteoclast differentiation; regulation of protein amino acid phosphorylation; regulation of protein secretion; response to glucocorticoid stimulus; response to lipopolysaccharide; response to organic substance; response to virus; sequestering of triacylglycerol; signal transduction; toll-like receptor 3 signaling pathway; tumor necrosis factor-mediated signaling pathway

Research Articles on Tnf

Similar Products

Product Notes

The Tnf tnf (Catalog #AAA7115100) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 89-235aa; Partial. The amino acid sequence is listed below: DKPVAHVVAN HQVEEQLEWL SQRANALLAN GMDLKDNQLV VPADGLYLVY SQVLFKGQGC PDYVLLTHTV SRFAISYQEK VNLLSAVKSP CPKDTPEGAE LKPWYEPIYL GGVFQLEKGD QLSAEVNLPK YLDFAESGQV YFGVIAL. It is sometimes possible for the material contained within the vial of "Tumor Necrosis Factor (Tnf), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.