SDF-1 active protein

SDF-1

Cat. Num. AAA515801

• Gene Names: CXCL10; C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• Applications: Cell Assay
• Synonyms: SDF-1; SDF-1 active protein

• Host: E Coli
• Form/Format: Recombinant protein stored in 1 X PBS, 10% glycerol.

• Applicable Applications for SDF-1 active protein: Cell Assay
• Endotoxin Level: Less than 0.1ng/ug (IEU/ug) of SDF-1
• Preparation and Storage: Store at desiccated below -20 degree C. It is stable at 4 degree C between 2-7 days. For long term storage, aliquot target into smaller quantities after centrifugation and store at recommended temperature. For most favorable performance, avoid repeated handling and multiple freeze/thaw cycles.

SDS-Page

(Purity: Sample Purity Data. For specific information on a given lot, see related technical data sheet.)

Related Product Information for SDF-1 active protein

This highly active SDF-1 contains 69 amino acids (MKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLK NNNRQVCIDPKLKWIQEYLEKALNK), which was derived from SDF-1-beta (3-72) and SDF-1-alpha (3-67). The SDF-1 protein was expressed in E Coli cells and purified by proprietary chromatographic techniques.
SDF-1 or stromal cell derived factor 1 is a member of the intercrine family which activate lymphocytes and have been used in the metastasis of some cancers such as breast cancer. SDF-1 is a chemokine receptor involved in a number of pathobiologic processes, including cell growth, survival, and adhesion, as well as tumor growth (1). SDF-1 plays a major role in the etiology of benign proliferative disease in an aging tissue microenvironment (2).

Product Categories/Family for SDF-1 active protein

Chemokines; AKT/PKB Pathway; Cancer; ERK/MAPK Pathway; Inflammation; Invasion/Metastasis; JNK/SAPK Pathway; NfkB Pathway; p38 Pathway; PKA/PKC Pathway

References

1. Burns, J. M. et.al: A novel chemokine receptor for SDF-1 and I-TAC involved in cell survival, cell adhesion, and tumor development. J. Exp. Med. 203: 2201-2213, 2006.
2. Begley, L. A. et.al: CXCL12 activates a robust transcriptional response in human prostate epithelial cells. J. Biol. Chem. 282: 26767-26774, 2007.

NCBI and Uniprot Product Information

• NCBI GI #: 149999382
• NCBI GeneID: 3627
• NCBI Accession #: NP_001556.2
• NCBI GenBank Nucleotide #: NM_001565.3
• UniProt Accession #: P02778; Q96QJ5
• Molecular Weight: 10,881 Da
• NCBI Official Full Name: C-X-C motif chemokine 10
• NCBI Official Synonym Full Names: chemokine (C-X-C motif) ligand 10
• NCBI Official Symbol: CXCL10
• NCBI Official Synonym Symbols: C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10
• NCBI Protein Information: C-X-C motif chemokine 10; gamma IP10; gamma-IP10; small-inducible cytokine B10; interferon-inducible cytokine IP-10; 10 kDa interferon gamma-induced protein; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X
• UniProt Protein Name: C-X-C motif chemokine 10
• UniProt Gene Name: CXCL10
• UniProt Synonym Gene Names: INP10; SCYB10; Gamma-IP10; IP-10
• UniProt Entry Name: CXL10_HUMAN

NCBI Description

This gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. [provided by RefSeq, Jul 2008]

Uniprot Description

CXCL10: Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Chemokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: heparin binding; protein binding; CXCR3 chemokine receptor binding; chemokine activity; cAMP-dependent protein kinase regulator activity; receptor binding

Biological Process: muscle development; blood circulation; protein secretion; positive regulation of leukocyte chemotaxis; positive regulation of cAMP metabolic process; chemotaxis; signal transduction; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; cell surface receptor linked signal transduction; response to vitamin D; cell-cell signaling; positive regulation of cell proliferation; response to gamma radiation; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of release of sequestered calcium ion into cytosol; response to cold; inflammatory response; negative regulation of myoblast differentiation; regulation of protein kinase activity; defense response to virus