Pro-Epidermal Growth Factor (Egf) Active Protein | Egf active protein

Recombinant Mouse Pro-Epidermal Growth Factor (Egf), Partial

Cat. Num. AAA7115006

• Gene Names: Egf; AI790464
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Pro-Epidermal Growth Factor (Egf); Recombinant Mouse Pro-Epidermal Growth Factor (Egf); Partial; Pro-epidermal growth factor; Epidermal growth factor; EGF; Egf active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
• Sequence Positions: 977-1029aa; Partial
• Sequence: NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR
• Sequence Length: 1217

• Species: Mouse
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 5 ng/ml.
• Subcellular Location: Membrane, Single-Pass Type I Membrane Protein
• Classification: Cytokine
• Subdivision: Growth Factor
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Egf active protein

Relevance: EGF is a single-pass type I membrane protein, containing 8 LDL-receptor class B repeats and 9 EGF-like domains. EGF results in cellular proliferation, differentiation, and survival. EGF is a low-molecular-weight polypeptide first purified from the mouse submandibular gland, but since then found in many human tissues including submandibular gland, parotid gland. Salivary EGF, which seems also regulated by dietary inorganic iodine, also plays an important physiological role in the maintenance of oro-esophageal and gastric tissue integrity. The biological effects of salivary EGF include healing of oral and gastroesophageal ulcers, inhibition of gastric acid secretion, stimulation of DNA synthesis as well as mucosal protection from intraluminal injurious factors such as gastric acid, bile acids, pepsin, and trypsin and to physical, chemical and bacterial agents.

Function: EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6 (By similarity).

Product Categories/Family for Egf active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 170172524
• NCBI GeneID: 13645
• NCBI Accession #: NP_034243.2
• NCBI GenBank Nucleotide #: NM_010113.4
• UniProt Accession #: P01132
• Molecular Weight: 7.2 kDa
• NCBI Official Full Name: pro-epidermal growth factor isoform 1 preproprotein
• NCBI Official Synonym Full Names: epidermal growth factor
• NCBI Official Symbol: Egf
• NCBI Official Synonym Symbols: AI790464
• NCBI Protein Information: pro-epidermal growth factor
• UniProt Protein Name: Pro-epidermal growth factor
• Protein Family: Pro-epidermal growth factor
• UniProt Gene Name: Egf
• UniProt Synonym Gene Names: EGF
• UniProt Entry Name: EGF_MOUSE

NCBI Description

This gene encodes epidermal growth factor (EGF), the founding member of the EGF family of growth factors that are implicated in cell proliferation and differentiation. The encoded protein can localize to the membrane and function in juxtacrine signaling or undergo proteolytic processing to generate a soluble form of the hormone. Mice lacking the encoded protein do not exhibit an abnormal phenotype but transgenic mice overexpressing the encoded protein exhibit hypospermatogenesis. [provided by RefSeq, Jul 2016]

Uniprot Description

EGF: EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Defects in EGF are the cause of hypomagnesemia type 4 (HOMG4); also known as renal hypomagnesemia normocalciuric. HOMG4 is a disorder characterized by massive renal hypomagnesemia and normal levels of serum calcium and calcium excretion. Clinical features include seizures, mild-to mederate psychomotor retardation, and brisk tendon reflexes. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hormone; Ligand, receptor tyrosine kinase; Membrane protein, integral

Cellular Component: extracellular space; lysosomal membrane; plasma membrane; receptor complex

Molecular Function: epidermal growth factor receptor binding; growth factor activity; protein binding; protein-tyrosine kinase activity; Wnt receptor activity; Wnt-protein binding

Biological Process: activation of MAPK activity; activation of MAPKK activity; angiogenesis; branching morphogenesis of a tube; epidermal growth factor receptor signaling pathway; negative regulation of secretion; peptidyl-tyrosine phosphorylation; positive regulation of cell proliferation; positive regulation of DNA binding; positive regulation of epidermal growth factor receptor activity; positive regulation of fibroblast proliferation; positive regulation of granule cell precursor proliferation; positive regulation of MAP kinase activity; positive regulation of mitosis; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of phosphorylation; positive regulation of transcription, DNA-dependent; regulation of peptidyl-tyrosine phosphorylation; regulation of protein secretion; regulation of protein transport; STAT protein nuclear translocation; Wnt receptor signaling pathway through beta-catenin