Interleukin-4 (Il4) Active Protein | Il4 active protein

Recombinant Mouse Interleukin-4 (Il4), Partial

Cat. Num. AAA7115078

• Gene Names: Il4; Il-4; BSF-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-4 (Il4); Recombinant Mouse Interleukin-4 (Il4); Partial; Interleukin-4; B-cell IgG differentiation factor; B-cell growth factor 1; B-cell stimulatory factor 1; IGG1 induction factor; Lymphocyte stimulatory factor 1; IL-4; BSF-1; Il4 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
• Sequence Positions: 23-140aa; Partial
• Sequence: HGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESKSTSLKDFLESLKSIMQMDYS
• Sequence Length: 140

• Species: Mouse
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells is less than 2 ng/ml.
• Subcellular Location: Secreted
• Protein Families: IL-4/IL-13 Family
• Classification: Cytokine
• Subdivision: Interleukin
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Il4 active protein

Relevance: Mouse Interleukin-4(IL-4) is a monomeric, Th2 cytokine that shows pleiotropic effects during immune responses. It is a glycosylated polypeptide that contains three intrachain disulfide bridges and adopts a bundled four alpha-helix structure. IL-4 exerts its effects through two receptor complexes, Participates in at least several B-cell activation processes as well as of other cell types. IL-4 is primarily expressed by Th2-biased CD4+T cells, mast cells, basophils, and eosinophils. It promotes cell proliferation, survival, and immunoglobulin class switch to IgG1 and IgE in mouse B cells, acquisition of the Th2 phenotype by naïve CD4+T cells, priming and chemotaxis of mast cells, eosinophils, and basophils, and the proliferation and activation of epithelial cells. IL-4 plays a dominant role in the development of allergic inflammation and asthma. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes.

Function: Participates in at least several B-cell activation processes as well as of other cell types.

Product Categories/Family for Il4 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 10946584
• NCBI GeneID: 16189
• NCBI Accession #: NP_067258.1
• NCBI GenBank Nucleotide #: NM_021283.2
• UniProt Accession #: P07750
• Molecular Weight: 13.4 kDa
• NCBI Official Full Name: interleukin-4
• NCBI Official Synonym Full Names: interleukin 4
• NCBI Official Symbol: Il4
• NCBI Official Synonym Symbols: Il-4; BSF-1
• NCBI Protein Information: interleukin-4
• UniProt Protein Name: Interleukin-4
• Protein Family: Interleukin
• UniProt Gene Name: Il4
• UniProt Synonym Gene Names: Il-4; IL-4; BSF-1
• UniProt Entry Name: IL4_MOUSE

Uniprot Description

IL4: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes. Genetic variations in IL4 may be a cause of susceptibility to ischemic stroke (ISCHSTR); also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors. Belongs to the IL-4/IL-13 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; Secreted, signal peptide; Motility/polarity/chemotaxis; Cytokine; Secreted

Cellular Component: extracellular space; extracellular region; external side of plasma membrane

Molecular Function: growth factor activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine activity; interleukin-4 receptor binding

Biological Process: negative regulation of osteoclast differentiation; positive regulation of isotype switching to IgG isotypes; positive regulation of transcription, DNA-dependent; microglial cell activation; regulation of proton transport; positive regulation of activated T cell proliferation; positive regulation of interleukin-10 production; positive regulation of isotype switching to IgE isotypes; B cell costimulation; positive regulation of MHC class II biosynthetic process; positive regulation of cell proliferation; positive regulation of B cell proliferation; positive regulation of T cell proliferation; positive regulation of interleukin-13 production; negative regulation of macrophage activation; cholesterol metabolic process; negative regulation of chronic inflammatory response; regulation of immune response; B cell activation; negative regulation of nitric oxide biosynthetic process; negative regulation of acute inflammatory response; positive regulation of mast cell degranulation; defense response to protozoan; positive regulation of immunoglobulin production; T-helper 1 cell lineage commitment; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of chemokine biosynthetic process; positive regulation of T cell differentiation; positive regulation of tyrosine phosphorylation of Stat5 protein; innate immune response in mucosa; positive regulation of B cell activation; regulation of inflammatory response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; immune response; positive regulation of protein amino acid phosphorylation; T-helper 2 cell differentiation; positive regulation of defense response to virus by host; negative regulation of transcription, DNA-dependent; negative regulation of T cell activation