Interleukin-33 (Il33) Active Protein | Il33 active protein

Recombinant Mouse Interleukin-33 (Il33), Partial

Cat. Num. AAA7115022

• Gene Names: Il33; Il-33; Il1f11; NF-HEV; 9230117N10Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-33 (Il33); Recombinant Mouse Interleukin-33 (Il33); Partial; Interleukin 33; IL-33; IL33; C9orf26; NKHEV; Interleukin-1 family member 11; DVS27; NF-HEV and IL- 1F11; Il33 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 109-266aa; Partial
• Sequence: SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
• Sequence Length: 266

• Species: Mouse
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The activity is as determined by its binding ability in a functional ELISA. Immobilized recombinant mouse IL33 at 5 mug/mL can bind mouse IL1RL1 with a linear range of 0.625-5ug/ml.
• Subcellular Location: Nucleus, Chromosome, Cytoplasmic Vesicle, secretory Vesicle, Secreted
• Protein Families: IL-1 Family
• Classification: Cytokine
• Subdivision: Interferon
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Il33 active protein

Relevance: Mouse Interleukin 33 (IL-33) is a 30 kDa proinflammatory cytokine which may also regulates gene transcription in producer cells. IL-33 is constitutively expressed in smooth muscle and airway epithelia. IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. It is up-regulated in arterial smooth muscle, dermal fibroblasts, and keratinocytes following IL-1 alpha or IL-1 beta stimulation. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and also leads to severe pathological changes in mucosal organs.

Function: Cytokine that binds to and signals through the IL1RL1/ST2 receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Involved in the maturation of Th2 cells inducing the secretion of T-helper type 2-associated cytokines. Also involved in activation of mast cells, basophils, eosinophils and natural killer cells. Acts as a chemoattractant for Th2 cells, and may function as an "alarmin", that amplifies immune responses during tissue injury.

Product Categories/Family for Il33 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 257900495
• NCBI GeneID: 77125
• NCBI Accession #: NP_001158196.1
• NCBI GenBank Nucleotide #: NM_001164724.2
• UniProt Accession #: Q8BVZ5
• Molecular Weight: 17.6 kDa
• NCBI Official Full Name: interleukin-33
• NCBI Official Synonym Full Names: interleukin 33
• NCBI Official Symbol: Il33
• NCBI Official Synonym Symbols: Il-33; Il1f11; NF-HEV; 9230117N10Rik
• NCBI Protein Information: interleukin-33
• UniProt Protein Name: Interleukin-33
• Protein Family: Interleukin
• UniProt Gene Name: Il33
• UniProt Synonym Gene Names: IL-33
• UniProt Entry Name: IL33_MOUSE

Uniprot Description

IL33: Cytokine that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. Induces T-helper type 2-associated cytokines. Belongs to the IL-1 family. Highly divergent. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytokine

Cellular Component: nucleus

Molecular Function: cytokine activity

Biological Process: defense response to virus; macrophage activation during immune response; microglial cell activation during immune response; negative regulation of immunoglobulin secretion; negative regulation of interferon-gamma production; negative regulation of leukocyte migration; negative regulation of T-helper 1 type immune response; positive regulation of immunoglobulin secretion; positive regulation of inflammatory response; positive regulation of interleukin-13 production; positive regulation of interleukin-4 production; positive regulation of interleukin-5 production; positive regulation of interleukin-6 production; positive regulation of macrophage activation; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of T-helper 2 type immune response; positive regulation of transcription from RNA polymerase II promoter