Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-NPSR1 Polyclonal Antibody)

Rabbit anti-Mouse NPSR1 Polyclonal Antibody | anti-NPSR1 antibody

NPSR1 Polyclonal Antibody

Gene Names
NPSR1; GPRA; NPSR; VRR1; ASRT2; PGR14; GPR154
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
NPSR1; Polyclonal Antibody; NPSR1 Polyclonal Antibody; ASRT2; GPR154; GPRA; NPSR; PGR14; VRR1; neuropeptide S receptor; anti-NPSR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.57 mg/ml (varies by lot)
Sequence Length
371
Applicable Applications for anti-NPSR1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human NPSR1 (NP_001287863.1).
Immunogen Sequence
SKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERHEMQILSKPEFI
Positive Samples
Mouse Lung, Mouse Thymus
Cellular Location
Cell Membrane, Cytoplasm, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-NPSR1 Polyclonal Antibody)

Western Blot (WB) (Western blot-NPSR1 Polyclonal Antibody)
Related Product Information for anti-NPSR1 antibody
This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Polymorphisms in this gene have also been associated with asthma susceptibility, panic disorders, inflammatory bowel disease, and rheumatoid arthritis. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 10-18kDa, 35-44kDa
Observed: 43kDa
NCBI Official Full Name
neuropeptide S receptor isoform A
NCBI Official Synonym Full Names
neuropeptide S receptor 1
NCBI Official Symbol
NPSR1
NCBI Official Synonym Symbols
GPRA; NPSR; VRR1; ASRT2; PGR14; GPR154
NCBI Protein Information
neuropeptide S receptor
UniProt Protein Name
Neuropeptide S receptor
Protein Family
UniProt Gene Name
NPSR1
UniProt Synonym Gene Names
GPR154; GPRA; PGR14
UniProt Entry Name
NPSR1_HUMAN

NCBI Description

This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Polymorphisms in this gene have also been associated with asthma susceptibility, panic disorders, inflammatory bowel disease, and rheumatoid arthritis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

NPSR1: May be active in signaling pathway in an autocrine or paracrine fashion in several tissues. Receptor for neuropeptide S, it may mediate its action, such as inhibitory effects, on cell growth. Involved in pathogenesis of asthma and other IgE-mediated diseases. Defects in NPSR1 are a cause of asthma-related traits type 2 (ASRT2). Asthma-related traits include clinical symptoms of asthma, such as coughing, wheezing, dyspnea, bronchial hyperresponsiveness as assessed by methacholine challenge test, serum IgE levels, atopy and atopic dermatitis. Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 7p14.3

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: neuropeptide receptor activity; vasopressin receptor activity

Biological Process: neuropeptide signaling pathway; positive regulation of release of sequestered calcium ion into cytosol

Disease: Asthma-related Traits, Susceptibility To, 2

Research Articles on NPSR1

Similar Products

Product Notes

The NPSR1 npsr1 (Catalog #AAA9140953) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPSR1 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NPSR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the NPSR1 npsr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NPSR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.