Interleukin-3 (IL3) Active Protein | IL3 active protein

Recombinant Human Interleukin-3 (IL3)

Cat. Num. AAA7115050

• Gene Names: IL3; IL-3; MCGF; MULTI-CSF
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-3 (IL3); Recombinant Human Interleukin-3 (IL3); Interleukin-3; IL-3; Hematopoietic Growth Factor; Mast Cell Growth Factor; MCGF; Multipotential Colony-Stimulating Factor; P-Cell-Stimulating Factor; IL3; IL3 active protein

• Host: E Coli
• Specificity: Activated T-cells, mast cells, natural killer cells.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 20-152aa; Full Length of Mature Protein
• Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
• Sequence Length: 152

• Species: Human
• Tag: N-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using TF-1 human erythroleukemic cells is less than 0.5 ng/ml.
• Subcellular Location: Secreted
• Protein Families: IL-3 Family
• Classification: Cytokine
• Subdivision: Interleukin
• Pathway: Jak-STAT Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IL3 active protein

Relevance: Interleukin-3 (IL-3) is a potent growth promoting cytokine. IL-3 can stimulate the proliferation and differentiation of pluripotent hematopoietic stem cells as well as various lineage committed progenitors. IL-3 exerts its biological function through binding to specific cell surface receptors. The amino acid sequences of this protein among different species share relatively low identity and its activity is highly species-specific. IL-3 has also been shown to possess neurotrophic activity, and is thought to be associated with neurologic disorders.

Function: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.

Product Categories/Family for IL3 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 3002475
• NCBI GeneID: 3562
• UniProt Accession #: P08700
• Molecular Weight: 16.6 kDa
• NCBI Official Full Name: IL-3
• NCBI Official Synonym Full Names: interleukin 3
• NCBI Official Symbol: IL3
• NCBI Official Synonym Symbols: IL-3; MCGF; MULTI-CSF
• NCBI Protein Information: interleukin-3
• UniProt Protein Name: Interleukin-3
• Protein Family: Interleukin
• UniProt Gene Name: IL3
• UniProt Synonym Gene Names: IL-3; MCGF
• UniProt Entry Name: IL3_HUMAN

NCBI Description

The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq, Jul 2008]

Uniprot Description

IL3: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. Belongs to the IL-3 family.

Protein type: Cytokine; Oncoprotein; Apoptosis; Secreted; Secreted, signal peptide; Cell cycle regulation

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: extracellular space; extracellular region

Molecular Function: interleukin-3 receptor binding; growth factor activity; cytokine activity

Biological Process: nervous system development; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of tyrosine phosphorylation of Stat5 protein; cell-cell signaling; embryonic hemopoiesis; cytokine and chemokine mediated signaling pathway; positive regulation of cell proliferation; immune response; positive regulation of myeloid leukocyte differentiation; positive regulation of DNA replication