Testing Data
(Detection limit for recombinant GST tagged HOXB6 is 0.03 ng/ml as a capture antibody.)
Mouse HOXB6 Monoclonal Antibody | anti-HOXB6 antibody
HOXB6 (Homeobox B6, HOX2, HOX2B, HU-2, Hox-2.2) (FITC)
Applications
Western Blot
Purity
Purified
Synonyms
HOXB6; Monoclonal Antibody; HOXB6 (Homeobox B6; HOX2; HOX2B; HU-2; Hox-2.2) (FITC); Homeobox B6; Hox-2.2; anti-HOXB6 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8000
Specificity
Recognizes HOXB6.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HOXB6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HOXB6 (NP_724779.1, 1aa-57aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSS
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged HOXB6 is 0.03 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged HOXB6 is 0.03 ng/ml as a capture antibody.)
Western Blot (WB)
(Western Blot analysis of HOXB6 expression in transfected 293T cell line by HOXB6 monoclonal antibody (M01), clone 8E3.Lane 1: HOXB6 transfected lysate (Predicted MW: 25.4 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of HOXB6 expression in transfected 293T cell line by HOXB6 monoclonal antibody (M01), clone 8E3.Lane 1: HOXB6 transfected lysate (Predicted MW: 25.4 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-HOXB6 antibody
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. [provided by RefSeq]
Product Categories/Family for anti-HOXB6 antibody
NCBI and Uniprot Product Information
NCBI GI #
Protein Family
Similar Products
Product Notes
The HOXB6 (Catalog #AAA6179016) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HOXB6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HOXB6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HOXB6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
