Interleukin-22 (IL22) Active Protein | IL22 active protein
Recombinant Human Interleukin-22 (IL22), Partial
Gene Names
IL22; TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-22 (IL22); Recombinant Human Interleukin-22 (IL22); Partial; Interleukin-22; IL-22; Cytokine Zcyto18; IL-10-related T-cell-derived-inducible factor; IL-TIF; IL22; ILTIF; ZCYTO18; IL22 active protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
34-179aa; Partial
Sequence
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Sequence Length
179
Species
Human
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells is less than 1 ng/ml.
Subcellular Location
Secreted
Protein Families
IL-10 Family
Classification
Cytokine
Subdivision
Interleukin
Pathway
Jak-STAT Signaling Pathway
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for IL22 active protein
Relevance: Interleukin-22(IL-22) is a member of a group of the IL-10 family, a class of potent mediators of cellular inflammatory responses. IL-22 is produced by activated DC and T cells. IL-22 and IL-10 receptor chains play a role in cellular targeting and signal transduction. It can initiate and regulate innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. IL-22 along with IL-17 likely plays a role in the coordinated response of both adaptive and innate immune systems. IL-22 also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. Biological activity of IL-22 is initiated by binding to a cell-surface complex consisting of IL-22R1 and IL-10R2 receptor chains. IL-22 biological activity is further regulated by interactions with a soluble binding protein, IL-22BP. IL-22BP and an extracellular region of IL-22R1 share sequence similarity. In some cases, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by cytokine IL-17A.
Function: Cytokine that contributes to the inflammatory response in vivo.
Function: Cytokine that contributes to the inflammatory response in vivo.
Product Categories/Family for IL22 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.9 kDa
NCBI Official Full Name
interleukin-22
NCBI Official Synonym Full Names
interleukin 22
NCBI Official Symbol
IL22
NCBI Official Synonym Symbols
TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23
NCBI Protein Information
interleukin-22
UniProt Protein Name
Interleukin-22
Protein Family
UniProt Gene Name
IL22
UniProt Synonym Gene Names
ILTIF; ZCYTO18; IL-22; IL-TIF
UniProt Entry Name
IL22_HUMAN
NCBI Description
This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. [provided by RefSeq, Jul 2018]
Uniprot Description
IL22: Cytokine that contributes to the inflammatory response in vivo. Belongs to the IL-10 family.
Protein type: Secreted, signal peptide; Cytokine; Secreted
Chromosomal Location of Human Ortholog: 12q15
Cellular Component: extracellular space; extracellular region
Molecular Function: interleukin-22 receptor binding; cytokine activity
Biological Process: cell-cell signaling; response to glucocorticoid stimulus; acute-phase response; inflammatory response
Research Articles on IL22
Similar Products
Product Notes
The IL22 il22 (Catalog #AAA7115033) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 34-179aa; Partial. The amino acid sequence is listed below: APISSHCRLD KSNFQQPYIT NRTFMLAKEA SLADNNTDVR LIGEKLFHGV SMSERCYLMK QVLNFTLEEV LFPQSDRFQP YMQEVVPFLA RLSNRLSTCH IEGDDLHIQR NVQKLKDTVK KLGESGEIKA IGELDLLFMS LRNACI. It is sometimes possible for the material contained within the vial of "Interleukin-22 (IL22), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
