Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interleukin-1 alpha (Il1a) Active Protein | Il1a active protein

Recombinant Mouse Interleukin-1 alpha (Il1a)

Gene Names
Il1a; Il-1a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-1 alpha (Il1a); Recombinant Mouse Interleukin-1 alpha (Il1a); Interleukin-1 Alpha; IL-1 Alpha; Il1a; Il1a active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 50 mM Tris-HCl, 0.2 M NaCl, pH 8.0
Sequence Positions
115-270aa; Full Length of Mature Protein
Sequence
SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
Sequence Length
270
Species
Mouse
Tag
Tag-Free
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using mouse D10S cells is less than 20 pg/mL.
Subcellular Location
Secreted
Protein Families
IL-1 Family
Classification
Cytokine
Subdivision
Interleukin
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Il1a active protein
Relevance: Mouse Interleukin-1 (IL-1) designates two proteins, IL-1alpha and IL-1beta, which are the products of distinct genes, but recognize the same cell surface receptors. IL-1alpha and IL-1beta are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17. 5 kDa.

Function: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Product Categories/Family for Il1a active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18 kDa
NCBI Official Full Name
interleukin-1 alpha
NCBI Official Synonym Full Names
interleukin 1 alpha
NCBI Official Symbol
Il1a
NCBI Official Synonym Symbols
Il-1a
NCBI Protein Information
interleukin-1 alpha
UniProt Protein Name
Interleukin-1 alpha
Protein Family
UniProt Gene Name
Il1a
UniProt Synonym Gene Names
IL-1 alpha
UniProt Entry Name
IL1A_MOUSE

Uniprot Description

IL1A: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Belongs to the IL-1 family.

Protein type: Cytokine; Motility/polarity/chemotaxis

Cellular Component: cell surface; cytoplasm; cytosol; extracellular space; plasma membrane

Molecular Function: copper ion binding; cytokine activity; interleukin-1 receptor binding

Biological Process: connective tissue replacement during inflammatory response; cytokine and chemokine mediated signaling pathway; germ cell programmed cell death; inflammatory response; keratinization; negative regulation of cell proliferation; positive regulation of angiogenesis; positive regulation of cytokine secretion; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-2 biosynthetic process; positive regulation of interleukin-6 production; positive regulation of JNK cascade; positive regulation of mitosis; positive regulation of prostaglandin secretion; positive regulation of protein secretion; positive regulation of stress-activated MAPK cascade; positive regulation of transcription from RNA polymerase II promoter; regulation of actin cytoskeleton organization and biogenesis; regulation of sensory perception of pain; response to copper ion

Research Articles on Il1a

Similar Products

Product Notes

The Il1a il1a (Catalog #AAA7115069) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 115-270aa; Full Length of Mature Protein. The amino acid sequence is listed below: SAPYTYQSDL RYKLMKLVRQ KFVMNDSLNQ TIYQDVDKHY LSTTWLNDLQ QEVKFDMYAY SSGGDDSKYP VTLKISDSQL FVSAQGEDQP VLLKELPETP KLITGSETDL IFFWKSINSK NYFTSAAYPE LFIATKEQSR VHLARGLPSM TDFQIS. It is sometimes possible for the material contained within the vial of "Interleukin-1 alpha (Il1a), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.