Interleukin-1 alpha (Il1a) Active Protein | Il1a active protein

Recombinant Mouse Interleukin-1 alpha (Il1a)

Cat. Num. AAA7115069

• Gene Names: Il1a; Il-1a
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-1 alpha (Il1a); Recombinant Mouse Interleukin-1 alpha (Il1a); Interleukin-1 Alpha; IL-1 Alpha; Il1a; Il1a active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 50 mM Tris-HCl, 0.2 M NaCl, pH 8.0
• Sequence Positions: 115-270aa; Full Length of Mature Protein
• Sequence: SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS
• Sequence Length: 270

• Species: Mouse
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using mouse D10S cells is less than 20 pg/mL.
• Subcellular Location: Secreted
• Protein Families: IL-1 Family
• Classification: Cytokine
• Subdivision: Interleukin
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Il1a active protein

Relevance: Mouse Interleukin-1 (IL-1) designates two proteins, IL-1alpha and IL-1beta, which are the products of distinct genes, but recognize the same cell surface receptors. IL-1alpha and IL-1beta are structurally related polypeptides that show approximately 25% homology at the amino acid level. Both proteins are produced by a wide variety of cells in response to stimuli such as those produced by inflammatory agents, infections, or microbial endotoxins. The proteins are synthesized as 31 kDa precursors that are subsequently cleaved into proteins with molecular weights of approximately 17. 5 kDa.

Function: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Product Categories/Family for Il1a active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 47059075
• NCBI GeneID: 16175
• NCBI Accession #: NP_034684.2
• NCBI GenBank Nucleotide #: NM_010554.4
• UniProt Accession #: P01582
• Molecular Weight: 18 kDa
• NCBI Official Full Name: interleukin-1 alpha
• NCBI Official Synonym Full Names: interleukin 1 alpha
• NCBI Official Symbol: Il1a
• NCBI Official Synonym Symbols: Il-1a
• NCBI Protein Information: interleukin-1 alpha
• UniProt Protein Name: Interleukin-1 alpha
• Protein Family: Interleukin
• UniProt Gene Name: Il1a
• UniProt Synonym Gene Names: IL-1 alpha
• UniProt Entry Name: IL1A_MOUSE

Uniprot Description

IL1A: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Belongs to the IL-1 family.

Protein type: Cytokine; Motility/polarity/chemotaxis

Cellular Component: cell surface; cytoplasm; cytosol; extracellular space; plasma membrane

Molecular Function: copper ion binding; cytokine activity; interleukin-1 receptor binding

Biological Process: connective tissue replacement during inflammatory response; cytokine and chemokine mediated signaling pathway; germ cell programmed cell death; inflammatory response; keratinization; negative regulation of cell proliferation; positive regulation of angiogenesis; positive regulation of cytokine secretion; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-2 biosynthetic process; positive regulation of interleukin-6 production; positive regulation of JNK cascade; positive regulation of mitosis; positive regulation of prostaglandin secretion; positive regulation of protein secretion; positive regulation of stress-activated MAPK cascade; positive regulation of transcription from RNA polymerase II promoter; regulation of actin cytoskeleton organization and biogenesis; regulation of sensory perception of pain; response to copper ion