Insulin-Like Growth Factor II (IGF2) Active Protein | IGF2 active protein

Recombinant Human Insulin-Like Growth Factor II (IGF2)

Cat. Num. AAA7114986

• Gene Names: IGF2; GRDF; IGF-II; PP9974; C11orf43
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Insulin-Like Growth Factor II (IGF2); Recombinant Human Insulin-Like Growth Factor II (IGF2); Insulin-Like Growth Factor II; IGF-II; Somatomedin-A; IGF2; PP1446; IGF2 active protein

• Host: E Coli
• Specificity: Expressed in heart, placenta, lung, liver, muscle, kidney, tongue, limb, eye and pancreas.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 5 mM HAC, PH 3.0
• Sequence Positions: 25-91aa; Full Length of Mature Protein
• Sequence: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
• Sequence Length: 180

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a serum-free cell proliferation assay using MCF-7 human breast cancer cells is less than 20 ng/ml.
• Subcellular Location: Secreted
• Protein Families: Insulin Family
• Classification: Cytokine
• Subdivision: Growth Factor
• Pathway: MAPK Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IGF2 active protein

Relevance: Insulin-Like Growth Factor II (IGF2) belongs to the insulin family of polypeptide growth factors that is involved in development and growth. Members of this family are structurally homologous to proinsulin, and share higher sequence identity. IGF2 is expressed only from the paternally inherited allele and believed to be secreted by the liver and to circulate in the blood. IGF2 possess growth-promoting activity and can stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. IGF2 is influenced by placental lactogen and may play a role in fetal development.

Function: The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (By similarity). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable).

Product Categories/Family for IGF2 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 124255
• NCBI GeneID: 3481
• UniProt Accession #: P01344
• Molecular Weight: 8.91 kDa
• NCBI Official Full Name: Insulin-like growth factor II
• NCBI Official Synonym Full Names: insulin like growth factor 2
• NCBI Official Symbol: IGF2
• NCBI Official Synonym Symbols: GRDF; IGF-II; PP9974; C11orf43
• NCBI Protein Information: insulin-like growth factor II
• UniProt Protein Name: Insulin-like growth factor II
• Protein Family: Insulin-like growth factor
• UniProt Gene Name: IGF2
• UniProt Synonym Gene Names: IGF-II
• UniProt Entry Name: IGF2_HUMAN

NCBI Description

This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5' region overlaps the INS gene and the 3' region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]