Fibroblast Growth Factor 9 (Fgf9) Active Protein | Fgf9 active protein

Recombinant Mouse Fibroblast Growth Factor 9 (Fgf9)

Cat. Num. AAA7115010

• Gene Names: Fgf9; Eks
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Fibroblast Growth Factor 9 (Fgf9); Recombinant Mouse Fibroblast Growth Factor 9 (Fgf9); Fibroblast growth factor 9; FGF-9; Glia-activating factor; GAF; heparin-binding growth factor-9; HBGF-9; Fgf9; Fgf-9; Fgf9 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: 0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, 5% Trehalose, 1 mM EDTA, 20% Glycerol, 1 mM DTT, pH 8.5
• Sequence Positions: 1-208aa; Full Length
• Sequence: MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Sequence Length: 208

• Species: Mouse
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 10 ng/ml.
• Subcellular Location: Secreted
• Protein Families: Heparin-Binding Growth Factors Family
• Classification: Cytokine
• Subdivision: Growth Factor
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Fgf9 active protein

Relevance: Fibroblast growth factor-9 (FGF-9) is an approximately 26 kDa secreted glycoprotein of the FGF family. Secreted mouse FGF-9 lacks the N-terminal 1-3 aa and shares >98% sequence identity with rat, human, equine, porcine and bovine FGF-9. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. In the mouse embryo the location and timing of FGF-9 expression affects development of the skeleton, cerebellum, lungs, heart, vasculature, digestive tract, and testes. It may have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. Deletion of mouse FGF-9 is lethal at birth due to lung hypoplasia, and causes rhizomelia, or shortening of the proximal skeleton. An unusual constitutive dimerization of FGF 9 buries receptor interaction sites which lowers its activity, and increases heparin affinity which inhibits diffusion. A spontaneous mouse mutant, Eks, interferes with dimerization, resulting monomeric, diffusible FGF-9 that causes elbow and knee synostoses (joint fusions) due to FGF-9 misexpression in developing joints.

Function: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.

Product Categories/Family for Fgf9 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 110625633
• NCBI GeneID: 14180
• NCBI Accession #: NP_038546.2
• NCBI GenBank Nucleotide #: NM_013518.4
• UniProt Accession #: P54130
• Molecular Weight: 24.4 kDa
• NCBI Official Full Name: fibroblast growth factor 9
• NCBI Official Synonym Full Names: fibroblast growth factor 9
• NCBI Official Symbol: Fgf9
• NCBI Official Synonym Symbols: Eks
• NCBI Protein Information: fibroblast growth factor 9
• UniProt Protein Name: Fibroblast growth factor 9
• Protein Family: Fibroblast growth factor
• UniProt Gene Name: Fgf9
• UniProt Synonym Gene Names: Fgf-9; FGF-9; GAF
• UniProt Entry Name: FGF9_MOUSE

Uniprot Description

FGF9: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. Defects in FGF9 are the cause of multiple synostoses syndrome type 3 (SYNS3). Multiple synostoses syndrome is an autosomal dominant condition characterized by progressive joint fusions of the fingers, wrists, ankles and cervical spine, characteristic facies and progressive conductive deafness. Belongs to the heparin-binding growth factors family.

Protein type: Cytokine

Cellular Component: extracellular space; cell; cytoplasm; extracellular region; basement membrane; intracellular

Molecular Function: heparin binding; growth factor activity; fibroblast growth factor receptor binding; receptor binding

Biological Process: negative regulation of Wnt receptor signaling pathway; positive regulation of transcription, DNA-dependent; multicellular organismal development; embryonic skeletal development; negative regulation of transcription from RNA polymerase II promoter; positive regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of activin receptor signaling pathway; positive regulation of MAPKKK cascade; cell-cell signaling; protein import into nucleus; male sex determination; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; positive regulation of smoothened signaling pathway; chondrocyte differentiation; angiogenesis; cell differentiation; regulation of timing of cell differentiation; embryonic gut development; positive regulation of cardiac muscle cell proliferation; embryonic limb morphogenesis; inner ear morphogenesis; fibroblast growth factor receptor signaling pathway; male gonad development; osteoblast differentiation; positive regulation of cell division; positive regulation of epithelial cell proliferation; lung development