Fibroblast Growth Factor 12 (FGF12) Active Protein | FGF12 active protein

Recombinant Human Fibroblast Growth Factor 12 (FGF12)

Cat. Num. AAA7114999

• Gene Names: FGF12; FHF1; EIEE47; FGF12B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Fibroblast Growth Factor 12 (FGF12); Recombinant Human Fibroblast Growth Factor 12 (FGF12); Fibroblast Growth Factor 12; FGF-12; Fibroblast Growth Factor Homologous Factor 1; FHF-1; Myocyte-Activating Factor; FGF12; FGF12B; FHF1; FGF12 active protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, 5 mM EDTA, pH 7.5
• Sequence Positions: 1-181aa; Full Length of Isoform 2
• Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
• Sequence Length: 243

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human FGF R3 in functional ELISA is less than 20 ug/ml.
• Classification: Cytokine
• Subdivision: Growth Factor
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for FGF12 active protein

Fibroblast Growth Factor 12 (FGF-12) is a member of the fibroblast growth factor (FGF) family. FGF-12 is probably involved in nervous system development and function. FGF-12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfectedinto mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported.

Product Categories/Family for FGF12 active protein

Cardiovascular

NCBI and Uniprot Product Information

• NCBI GI #: 47117683
• NCBI GeneID: 2257
• UniProt Accession #: P61328
• Molecular Weight: 20.45 kDa
• NCBI Official Full Name: Fibroblast growth factor 12
• NCBI Official Synonym Full Names: fibroblast growth factor 12
• NCBI Official Symbol: FGF12
• NCBI Official Synonym Symbols: FHF1; EIEE47; FGF12B
• NCBI Protein Information: fibroblast growth factor 12
• UniProt Protein Name: Fibroblast growth factor 12
• Protein Family: Fibroblast growth factor
• UniProt Gene Name: FGF12
• UniProt Synonym Gene Names: FGF12B; FHF1; FGF-12; FHF-1
• UniProt Entry Name: FGF12_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF12: Probably involved in nervous system development and function. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Cytokine

Chromosomal Location of Human Ortholog: 3q28

Cellular Component: extracellular space; nucleus

Molecular Function: heparin binding; growth factor activity; sodium channel regulator activity; fibroblast growth factor receptor binding

Biological Process: nervous system development; synaptic transmission; fibroblast growth factor receptor signaling pathway; cell-cell signaling; adult locomotory behavior; heart development; neuromuscular process; JNK cascade; signal transduction