Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human FGF-7/KGF Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

FGF-7/KGF Active Protein | KGF active protein

Recombinant Human FGF-7/KGF Protein

Gene Names
FGF7; KGF; HBGF-7
Purity
>95% by SDS-PAGE.
Synonyms
FGF-7/KGF; Recombinant Human FGF-7/KGF Protein; Fibroblast growth factor 7; FGF-7; Heparin-binding growth factor 7; HBGF-7; Keratinocyte growth factor; FGF7; KGF; KGF active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20mM PB, pH8.0, l50mM NaCl.
Sequence
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Sequence Length
194
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is typically 6-60 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human FGF-7/KGF Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human FGF-7/KGF Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for KGF active protein
Recombinant Human FGF-7/KGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Cys32-Thr194) of human FGF-7/KGF (Accession #P21781).
Product Categories/Family for KGF active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
fibroblast growth factor 7
NCBI Official Synonym Full Names
fibroblast growth factor 7
NCBI Official Symbol
FGF7
NCBI Official Synonym Symbols
KGF; HBGF-7
NCBI Protein Information
fibroblast growth factor 7
UniProt Protein Name
Fibroblast growth factor 7
UniProt Gene Name
FGF7
UniProt Synonym Gene Names
KGF; FGF-7; HBGF-7
UniProt Entry Name
FGF7_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF7: Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation. Belongs to the heparin-binding growth factors family.

Protein type: Secreted; Cytokine; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 15q21.2

Cellular Component: Golgi apparatus; extracellular region

Molecular Function: heparin binding; protein binding; growth factor activity; fibroblast growth factor receptor binding; chemoattractant activity

Biological Process: epidermal growth factor receptor signaling pathway; positive regulation of keratinocyte migration; epidermis development; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; hair follicle morphogenesis; nerve growth factor receptor signaling pathway; mesenchymal cell proliferation; signal transduction; positive regulation of peptidyl-tyrosine phosphorylation; positive chemotaxis; positive regulation of cell division; actin cytoskeleton reorganization; positive regulation of cell proliferation; response to wounding; insulin receptor signaling pathway; innate immune response; positive regulation of epithelial cell proliferation

Research Articles on KGF

Similar Products

Product Notes

The KGF fgf7 (Catalog #AAA9140328) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: CNDMTPEQMA TNVNCSSPER HTRSYDYMEG GDIRVRRLFC RTQWYLRIDK RGKVKGTQEM KNNYNIMEIR TVAVGIVAIK GVESEFYLAM NKEGKLYAKK ECNEDCNFKE LILENHYNTY ASAKWTHNGG EMFVALNQKG IPVRGKKTKK EQKTAHFLPM AIT. It is sometimes possible for the material contained within the vial of "FGF-7/KGF, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.