Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant protein Human FGF-4 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 16 kDa.)

FGF-4 active protein

Recombinant Human FGF-4 Protein

Gene Names
FGF4; HST; KFGF; FGF-4; HST-1; HSTF1; K-FGF; HBGF-4; HSTF-1
Purity
>95% by SDS-PAGE.
Synonyms
FGF-4; Recombinant Human FGF-4 Protein; HBGF-4; HST; HST-1; HSTF1; K-FGF; KFGF; FGF-4 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
Sequence
SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Sequence Length
206
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured in a cell proliferation assay using NR6R-3T3 mouse fibroblast cells. The ED50 for this effect is 0.25-1.25 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human FGF-4 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 16 kDa.)

SDS-Page (Recombinant protein Human FGF-4 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 16 kDa.)
Related Product Information for FGF-4 active protein
Description: Recombinant Human FGF-4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser54-Leu206) of human FGF-4 (Accession #P08620) fused with an initial Met at the N-terminus.

Background: This protein is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its oncogenic transforming activity. This gene and FGF3, another oncogenic growth factor, are located closely on chromosome 11. Co-amplification of both genes was found in various kinds of human tumors. Studies on the mouse homolog suggested a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway.
Product Categories/Family for FGF-4 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
fibroblast growth factor 4
NCBI Official Synonym Full Names
fibroblast growth factor 4
NCBI Official Symbol
FGF4
NCBI Official Synonym Symbols
HST; KFGF; FGF-4; HST-1; HSTF1; K-FGF; HBGF-4; HSTF-1
NCBI Protein Information
fibroblast growth factor 4
UniProt Protein Name
Fibroblast growth factor 4
UniProt Gene Name
FGF4
UniProt Synonym Gene Names
HST; HSTF1; KS3; FGF-4; HST; HST-1; HSTF-1; HBGF-4
UniProt Entry Name
FGF4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its oncogenic transforming activity. This gene and FGF3, another oncogenic growth factor, are located closely on chromosome 11. Co-amplification of both genes was found in various kinds of human tumors. Studies on the mouse homolog suggested a function in bone morphogenesis and limb development through the sonic hedgehog (SHH) signaling pathway. [provided by RefSeq, Jul 2008]

Uniprot Description

Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.

Research Articles on FGF-4

Similar Products

Product Notes

The FGF-4 fgf4 (Catalog #AAA9139800) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: SLARLPVAAQ PKEAAVQSGA GDYLLGIKRL RRLYCNVGIG FHLQALPDGR IGGAHADTRD SLLELSPVER GVVSIFGVAS RFFVAMSSKG KLYGSPFFTD ECTFKEILLP NNYNAYESYK YPGMFIALSK NGKTKKGNRV SPTMKVTHFL PRL. It is sometimes possible for the material contained within the vial of "FGF-4, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.