CCL19 active protein

Recombinant CCL19 (MIP-3β)

Cat. Num. AAA197063

• Gene Names: CCL19; ELC; CKb11; MIP3B; MIP-3b; SCYA19
• Purity: >97% by SDS-PAGE
• Synonyms: CCL19; Recombinant CCL19 (MIP-3β); Recombinant Human CCL19; CCL19 active protein

• Host: E. coli
• Purity/Purification: >97% by SDS-PAGE
• Form/Format: Sterile Filtered White Lyophilized Powder
• Sequence: GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS

• Host Note: Recombinant human CCL19 produced in E. coli (accession no. Q99731).
• Preservative: None
• Appearance: White powder
• Activity: EC50 = 30nM determined by calcium flux with recombinant human CCR7.
• Endotoxin Level: <0.01 EU per 1ug of protein by LAL method.
• Carrier Protein: None
• Reconstitution: Recommended at 100ug/ml in sterile distilled water.
• Preparation and Storage: 12 months from date of receipt, -20°C to -70°C, as supplied.; 1 month, 2°C to 8°C, under sterile conditions after reconstitution.; 3 months, -20°C to -70°C, under sterile conditions after reconstitution.

Related Product Information for CCL19 active protein

CCL19 (also known as Macrophage Inflammatory Protein-3β, MIP-3β, and EBI1 ligand chemokine, ELC) directs chemotaxis of dendritic cells and certain B- and T-lymphocytes, but not monocytes or granulocytes. It is constitutively expressed in thymus and lymph nodes and binds specifically to target cells expressing the receptor CCR7. As a homeostatic chemokine, its primary physiological role is thought to be in the normal recirculation and homing of lymphocytes. However, CCL19 can also be proinflammatory and is implicated in post-HIV infection responses.

NCBI and Uniprot Product Information

• NCBI GI #: 5454040
• NCBI GeneID: 6363
• NCBI Accession #: NP_006265.1
• NCBI GenBank Nucleotide #: NM_006274.2
• Molecular Weight: 8.8kDa by Mass Spec.
• NCBI Official Full Name: C-C motif chemokine 19
• NCBI Official Synonym Full Names: C-C motif chemokine ligand 19
• NCBI Official Symbol: CCL19
• NCBI Official Synonym Symbols: ELC; CKb11; MIP3B; MIP-3b; SCYA19
• NCBI Protein Information: C-C motif chemokine 19
• UniProt Protein Name: C-C motif chemokine 19
• Protein Family: C-C motif chemokine
• UniProt Gene Name: CCL19
• UniProt Synonym Gene Names: ELC; MIP3B; SCYA19; EBI1 ligand chemokine; ELC; MIP-3-beta
• UniProt Entry Name: CCL19_HUMAN

NCBI Description

This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7. [provided by RefSeq, Sep 2014]

Uniprot Description

CCL19: May play a role not only in inflammatory and immunological responses but also in normal lymphocyte recirculation and homing. May play an important role in trafficking of T-cells in thymus, and T-cell and B-cell migration to secondary lymphoid organs. Specifically binds to chemokine receptor CCR7. Recombinant CCL19 shows potent chemotactic activity for T-cells and B-cells but not for granulocytes and monocytes. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Secreted; Secreted, signal peptide; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: cell; extracellular region; extracellular space; intracellular

Molecular Function: CCR chemokine receptor binding; CCR10 chemokine receptor binding; CCR7 chemokine receptor binding; chemokine activity; chemokine receptor binding

Biological Process: activation of JNK activity; cell communication; cell maturation; cellular calcium ion homeostasis; dendritic cell chemotaxis; establishment of T cell polarity; formation of immunological synapse; G-protein coupled receptor protein signaling pathway; immune response; inflammatory response; lymphocyte chemotaxis; monocyte chemotaxis; myeloid dendritic cell chemotaxis; positive regulation of chemotaxis; positive regulation of dendritic cell antigen processing and presentation; positive regulation of endocytosis; positive regulation of GTPase activity; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-1 beta secretion; positive regulation of interleukin-12 production; positive regulation of JNK cascade; positive regulation of NF-kappaB import into nucleus; positive regulation of phosphoinositide 3-kinase activity; positive regulation of protein kinase activity; positive regulation of protein kinase B signaling cascade; positive regulation of receptor-mediated endocytosis; positive regulation of T cell proliferation; positive regulation of T-helper 1 cell differentiation; positive regulation of tumor necrosis factor production; release of sequestered calcium ion into cytosol; response to virus; T cell costimulation