Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dual specificity tyrosine-phosphorylation-regulated kinase 3 (Dyrk3) Recombinant Protein | Dyrk3 recombinant protein

Recombinant Mouse Dual specificity tyrosine-phosphorylation-regulated kinase 3 (Dyrk3)

Gene Names
Dyrk3; BC006704
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dual specificity tyrosine-phosphorylation-regulated kinase 3 (Dyrk3); Recombinant Mouse Dual specificity tyrosine-phosphorylation-regulated kinase 3 (Dyrk3); Dyrk3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-586, Full length protein
Sequence
MGGAARDRGRKDAALPGAGLPPQQRRLGDGVYDTFMMIDETKGPPYSDTFSNPSEAPVSRRLNITTEPLTRGHTQHFVNGSEMKVEQLFQEFGNRRSNTLQSDGISNSEKSSPASQGKSSESLSAVKCNLSSRPSKVLPLTPEQALKQYKHHLTAYEKLEIVSYPEIYFVGPNAKKRQGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSATKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGCRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMIELLGMPPQKLLEQSKRAKYFINSKGLPRYCSVSTQTDGRVVLLGGRSRRGKKRGPPGSKDWATALKGCGDYLFIEFLKRCLQWDPSARLTPAQALRHPWISKSTPKPLTMDKVPGKRVVNPTNAFQGLGSKLPPVVGIASKLKANLMSETSGSIPLCSVLPKLIS
Sequence Length
586
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Dyrk3 recombinant protein
This gene product belongs to the DYRK family of dual-specificity protein kinases that catalyze autophosphorylation on serine
threonine and tyrosine residues. The members of this family share structural similarity, however, differ in their substrate specificity, suggesting their involvement in different cellular functions. The encoded protein has been shown to autophosphorylate on tyrosine residue and catalyze phosphorylation of histones H3 and H2B in vitro. Alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65,572 Da
NCBI Official Full Name
dual specificity tyrosine-phosphorylation-regulated kinase 3
NCBI Official Synonym Full Names
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 3
NCBI Official Symbol
Dyrk3
NCBI Official Synonym Symbols
BC006704
NCBI Protein Information
dual specificity tyrosine-phosphorylation-regulated kinase 3
UniProt Protein Name
Dual specificity tyrosine-phosphorylation-regulated kinase 3
UniProt Gene Name
Dyrk3

Uniprot Description

Dual-specificity kinase which possesses both serine/threonine and tyrosine kinase activities. Negative regulator of EPO-dependent erythropoiesis, may place an upper limit on red cell production during stress erythropoiesis. Inhibits cell death due to cytokine withdrawal in hematopoietic progenitor cells (). May act by regulating CREB/CRE signaling (PubMed:12356771). Stabilizes and prevents stress granule disassembly thereby regulating mTORC1 signaling during cellular stress. During stressful conditions, DYRK3 partitions to the stress granule from the cytosol, as well as mTORC1 components, which prevents mTORC1 signaling. When stress signals are gone, the kinase activity of DYRK3 is required for the dissolution of stress granule and mTORC1 relocation to the cytosol, and promotes the phosphorylation of the mTORC1 inhibitor, AKT1S1, allowing full reactivation of mTORC1 signaling. Promotes cell survival upon genotoxic stress through phosphorylation of SIRT1. This in turn inhibits TP53 activity and apoptosis ().

Research Articles on Dyrk3

Similar Products

Product Notes

The Dyrk3 dyrk3 (Catalog #AAA1465857) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-586, Full length protein. The amino acid sequence is listed below: MGGAARDRGR KDAALPGAGL PPQQRRLGDG VYDTFMMIDE TKGPPYSDTF SNPSEAPVSR RLNITTEPLT RGHTQHFVNG SEMKVEQLFQ EFGNRRSNTL QSDGISNSEK SSPASQGKSS ESLSAVKCNL SSRPSKVLPL TPEQALKQYK HHLTAYEKLE IVSYPEIYFV GPNAKKRQGV IGGPNNGGYD DADGAYIHVP RDHLAYRYEV LKIIGKGSFG QVARVYDHKL RQYVALKMVR NEKRFHRQAA EEIRILEHLK KQDKTGSMNV IHMLESFTFR NHVCMAFELL SIDLYELIKK NKFQGFSVQL VRKFAQSILQ SLDALHKNKI IHCDLKPENI LLKHHGRSAT KVIDFGSSCF EYQKLYTYIQ SRFYRAPEII LGCRYSTPID IWSFGCILAE LLTGQPLFPG EDEGDQLACM IELLGMPPQK LLEQSKRAKY FINSKGLPRY CSVSTQTDGR VVLLGGRSRR GKKRGPPGSK DWATALKGCG DYLFIEFLKR CLQWDPSARL TPAQALRHPW ISKSTPKPLT MDKVPGKRVV NPTNAFQGLG SKLPPVVGIA SKLKANLMSE TSGSIPLCSV LPKLIS. It is sometimes possible for the material contained within the vial of "Dual specificity tyrosine-phosphorylation-regulated kinase 3 (Dyrk3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.