Protein deltex-4 (Dtx4) Recombinant Protein | Dtx4 recombinant protein
Recombinant Mouse Protein deltex-4 (Dtx4)
Gene Names
Dtx4; RNF155; AI449438; BC044798; D930042H13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein deltex-4 (Dtx4); Recombinant Mouse Protein deltex-4 (Dtx4); Dtx4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-616, Full length protein
Sequence
MLLASAVVVWEWLNEHGRWRPYSPAVSHHIEAVVRAGPRAGGSVVLGQVDSRLAPYIIDLQSMNQFRQDTGTLRPVRRNYYDPSSAPGKGVVWEWENDNGSWTPYDMEVGITIQYAYEKQHPWIDLTSIGFSYIIDFSTMGQINRQTQRQRRVRRRLDLIYPMVTGTMPKTQSWPVSPGPATSSPAPPCSCPQCVLVMSVKAAVVHGGTGPPAVRKNMALSGVGKLPQPPGPGAKPLDTTGTIRGPGKTAPSQVIRRQVSNAPAGATVGSPASPQGSNRKTGRVALATLNRSNLQRLAIAQSRVLIASGVPTVPVKNLNGSSPVNPALAGITGILMSAAGLPVCLTRPPKLVLHPPPVSKSEIKSIPGVSNTSRKTTKKQAKKGKTPEEVLKKYLQKVRHPPEEDCTICMERLTAPSGYKGPQPTVKPDLVGKLSRCGHIYHIYCLVAMYNNGNKDGSLQCPTCKTIYGVKTGTQPPGKMEYHLIPHSLPGHPDCKTIRIIYSIPPGIQGPEHPNPGKSFSARGFPRHCYLPDSEKGRKVLKLLLVAWDRRLIFAIGTSSTTGESDTVIWNEVHHKTEFGSNLTGHGYPDANYLDNVLAELAAQGISEDSTSHEKD
Sequence Length
616
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
66,821 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase DTX4
NCBI Official Synonym Full Names
deltex 4, E3 ubiquitin ligase
NCBI Official Symbol
Dtx4
NCBI Official Synonym Symbols
RNF155; AI449438; BC044798; D930042H13
NCBI Protein Information
E3 ubiquitin-protein ligase DTX4
UniProt Protein Name
E3 ubiquitin-protein ligase DTX4
Protein Family
UniProt Gene Name
Dtx4
UniProt Synonym Gene Names
Deltex4
Uniprot Description
Functions as a ubiquitin ligase protein in vivo, mediating 'Lys48'-linked polyubiquitination and promoting degradation of TBK1, targeting to TBK1 requires interaction with NLRP4 (). Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations.
Research Articles on Dtx4
Similar Products
Product Notes
The Dtx4 dtx4 (Catalog #AAA1331786) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-616, Full length protein. The amino acid sequence is listed below: MLLASAVVVW EWLNEHGRWR PYSPAVSHHI EAVVRAGPRA GGSVVLGQVD SRLAPYIIDL QSMNQFRQDT GTLRPVRRNY YDPSSAPGKG VVWEWENDNG SWTPYDMEVG ITIQYAYEKQ HPWIDLTSIG FSYIIDFSTM GQINRQTQRQ RRVRRRLDLI YPMVTGTMPK TQSWPVSPGP ATSSPAPPCS CPQCVLVMSV KAAVVHGGTG PPAVRKNMAL SGVGKLPQPP GPGAKPLDTT GTIRGPGKTA PSQVIRRQVS NAPAGATVGS PASPQGSNRK TGRVALATLN RSNLQRLAIA QSRVLIASGV PTVPVKNLNG SSPVNPALAG ITGILMSAAG LPVCLTRPPK LVLHPPPVSK SEIKSIPGVS NTSRKTTKKQ AKKGKTPEEV LKKYLQKVRH PPEEDCTICM ERLTAPSGYK GPQPTVKPDL VGKLSRCGHI YHIYCLVAMY NNGNKDGSLQ CPTCKTIYGV KTGTQPPGKM EYHLIPHSLP GHPDCKTIRI IYSIPPGIQG PEHPNPGKSF SARGFPRHCY LPDSEKGRKV LKLLLVAWDR RLIFAIGTSS TTGESDTVIW NEVHHKTEFG SNLTGHGYPD ANYLDNVLAE LAAQGISEDS TSHEKD. It is sometimes possible for the material contained within the vial of "Protein deltex-4 (Dtx4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
