Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Probable doxorubicin resistance ABC transporter permease protein drrC (drrC) Recombinant Protein | drrC recombinant protein

Recombinant Probable doxorubicin resistance ABC transporter permease protein drrC (drrC)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable doxorubicin resistance ABC transporter permease protein drrC (drrC); Recombinant Probable doxorubicin resistance ABC transporter permease protein drrC (drrC); Probable doxorubicin resistance ABC transporter permease protein drrC; drrC recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-276
Sequence
MITTTSQEIELAPTRLPGSQNAARLFVAQTLLQTNRLLTRWARDYITVIGAIVLPILFMVVLNIVLGNLAYVVTHDSGLYSIVPLIALGAAITGSTFVAIDLMRERSFGLLARLWVLPVHRASGLISRILANAIRTLVTTLVMLGTGVVLGFRFRQGLIPSLMWISVPVILGIAIAAMVTTVALYTAQTVVVEGVELVQAIAIFFSTGLVPLNSYPGWIQPFVAHQPVSYAIAAMRGFAMGGPVLSPMIGMLVWTAGICVVCAVPLAIGYRRASTH
Sequence Length
276
Species
Mycobacterium tuberculosis
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,593 Da
NCBI Official Full Name
daunorubicin-DIM-transport integral membrane protein ABC transporter DrrC
NCBI Official Symbol
drrC
NCBI Protein Information
daunorubicin-DIM-transport integral membrane protein ABC transporter DrrC
UniProt Protein Name
Probable doxorubicin resistance ABC transporter permease protein DrrC
UniProt Gene Name
drrC
UniProt Entry Name
DRRC_MYCTU

Uniprot Description

Function: Probably part of the ABC transporter complex DrrABC involved in doxorubicin resistance. Probably responsible for the translocation of the substrate across the membrane.

Subunit structure: The complex is composed of two ATP-binding proteins (DrrA) and two transmembrane proteins (DrrB and DrrC)

Potential.

Subcellular location: Cell membrane; Multi-pass membrane protein

Potential.

Miscellaneous: Was identified as a high-confidence drug target.

Sequence similarities: Belongs to the ABC-2 integral membrane protein family.Contains 1 ABC transmembrane type-2 domain.

Similar Products

Product Notes

The drrC drrc (Catalog #AAA1148808) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-276. The amino acid sequence is listed below: MITTTSQEIE LAPTRLPGSQ NAARLFVAQT LLQTNRLLTR WARDYITVIG AIVLPILFMV VLNIVLGNLA YVVTHDSGLY SIVPLIALGA AITGSTFVAI DLMRERSFGL LARLWVLPVH RASGLISRIL ANAIRTLVTT LVMLGTGVVL GFRFRQGLIP SLMWISVPVI LGIAIAAMVT TVALYTAQTV VVEGVELVQA IAIFFSTGLV PLNSYPGWIQ PFVAHQPVSY AIAAMRGFAM GGPVLSPMIG MLVWTAGICV VCAVPLAIGY RRASTH. It is sometimes possible for the material contained within the vial of "Probable doxorubicin resistance ABC transporter permease protein drrC (drrC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.